Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   HB751_RS05925 Genome accession   NZ_CP050272
Coordinates   1218256..1218486 (-) Length   76 a.a.
NCBI ID   WP_002275977.1    Uniprot ID   Q8DVP7
Organism   Streptococcus mutans strain P6     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1213256..1223486
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HB751_RS05900 (HB751_05900) - 1213286..1213807 (+) 522 WP_002264875.1 YgjV family protein -
  HB751_RS05905 (HB751_05905) - 1213914..1214735 (-) 822 WP_032505481.1 Cof-type HAD-IIB family hydrolase -
  HB751_RS05910 (HB751_05910) copZ 1214981..1215184 (-) 204 WP_002263706.1 copper chaperone CopZ -
  HB751_RS05915 (HB751_05915) - 1215197..1217425 (-) 2229 WP_019323085.1 heavy metal translocating P-type ATPase -
  HB751_RS05920 (HB751_05920) - 1217422..1217865 (-) 444 WP_002264871.1 CopY/TcrY family copper transport repressor -
  HB751_RS05925 (HB751_05925) cipB 1218256..1218486 (-) 231 WP_002275977.1 bacteriocin class II family protein Regulator
  HB751_RS05930 (HB751_05930) - 1218754..1219023 (+) 270 WP_167311805.1 hypothetical protein -
  HB751_RS05935 (HB751_05935) rbfA 1218965..1219315 (-) 351 WP_002262599.1 30S ribosome-binding factor RbfA -
  HB751_RS05940 (HB751_05940) infB 1219549..1221771 (-) 2223 Protein_1176 translation initiation factor IF-2 -
  HB751_RS10520 - 1222204..1222299 (-) 96 Protein_1177 translation initiation factor IF-2 N-terminal domain-containing protein -
  HB751_RS05945 (HB751_05945) - 1222320..1222622 (-) 303 WP_002262601.1 YlxQ-related RNA-binding protein -
  HB751_RS05950 (HB751_05950) rnpM 1222615..1222911 (-) 297 WP_002263922.1 RNase P modulator RnpM -

Sequence

Protein


Download         Length: 76 a.a.        Molecular weight: 7229.19 Da        Isoelectric Point: 3.7781

>NTDB_id=377879 HB751_RS05925 WP_002275977.1 1218256..1218486(-) (cipB) [Streptococcus mutans strain P6]
MNTQAFEQFNVMDNEALSTVEGGGMIRCALGTAGSAGLGFVGGMGAGTVTLPVVGTVSGAALGGWSGAAVGAATFC

Nucleotide


Download         Length: 231 bp        

>NTDB_id=377879 HB751_RS05925 WP_002275977.1 1218256..1218486(-) (cipB) [Streptococcus mutans strain P6]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAACTGTTGAGGGTGGTGGTATGATTAG
ATGTGCACTTGGCACAGCTGGTTCTGCAGGTTTAGGATTTGTAGGGGGTATGGGAGCTGGTACAGTTACTCTCCCAGTCG
TTGGTACAGTATCTGGAGCGGCATTAGGAGGCTGGTCTGGAGCAGCTGTAGGTGCTGCTACTTTTTGTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-70)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q8DVP7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

71.429

55.263

0.395

Multiple sequence alignment