Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   FQV73_RS06440 Genome accession   NZ_CP042271
Coordinates   1416070..1416243 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain LPL061     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1411070..1421243
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FQV73_RS06425 gcvT 1411888..1412988 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  FQV73_RS06430 - 1413411..1415081 (+) 1671 WP_003153107.1 SNF2-related protein -
  FQV73_RS06435 - 1415099..1415893 (+) 795 WP_014305407.1 YqhG family protein -
  FQV73_RS06440 sinI 1416070..1416243 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  FQV73_RS06445 sinR 1416277..1416612 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  FQV73_RS06450 - 1416660..1417445 (-) 786 WP_003153102.1 TasA family protein -
  FQV73_RS06455 - 1417509..1418093 (-) 585 WP_012117977.1 signal peptidase I -
  FQV73_RS06460 tapA 1418065..1418736 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  FQV73_RS06465 - 1418995..1419324 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  FQV73_RS06470 - 1419364..1419543 (-) 180 WP_003153093.1 YqzE family protein -
  FQV73_RS06475 comGG 1419600..1419977 (-) 378 WP_043867284.1 competence type IV pilus minor pilin ComGG Machinery gene
  FQV73_RS06480 comGF 1419978..1420373 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  FQV73_RS06485 comGE 1420387..1420701 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  FQV73_RS06490 comGD 1420685..1421122 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=376524 FQV73_RS06440 WP_003153105.1 1416070..1416243(+) (sinI) [Bacillus velezensis strain LPL061]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=376524 FQV73_RS06440 WP_003153105.1 1416070..1416243(+) (sinI) [Bacillus velezensis strain LPL061]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment