Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   FQV73_RS06485 Genome accession   NZ_CP042271
Coordinates   1420387..1420701 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain LPL061     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1415387..1425701
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FQV73_RS06440 sinI 1416070..1416243 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  FQV73_RS06445 sinR 1416277..1416612 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  FQV73_RS06450 - 1416660..1417445 (-) 786 WP_003153102.1 TasA family protein -
  FQV73_RS06455 - 1417509..1418093 (-) 585 WP_012117977.1 signal peptidase I -
  FQV73_RS06460 tapA 1418065..1418736 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  FQV73_RS06465 - 1418995..1419324 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  FQV73_RS06470 - 1419364..1419543 (-) 180 WP_003153093.1 YqzE family protein -
  FQV73_RS06475 comGG 1419600..1419977 (-) 378 WP_043867284.1 competence type IV pilus minor pilin ComGG Machinery gene
  FQV73_RS06480 comGF 1419978..1420373 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  FQV73_RS06485 comGE 1420387..1420701 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  FQV73_RS06490 comGD 1420685..1421122 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  FQV73_RS06495 comGC 1421112..1421378 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  FQV73_RS06500 comGB 1421425..1422462 (-) 1038 WP_043867286.1 competence type IV pilus assembly protein ComGB Machinery gene
  FQV73_RS06505 comGA 1422449..1423519 (-) 1071 WP_043867287.1 competence type IV pilus ATPase ComGA Machinery gene
  FQV73_RS06510 - 1423717..1424667 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=376527 FQV73_RS06485 WP_015388003.1 1420387..1420701(-) (comGE) [Bacillus velezensis strain LPL061]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=376527 FQV73_RS06485 WP_015388003.1 1420387..1420701(-) (comGE) [Bacillus velezensis strain LPL061]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment