Detailed information    

insolico Bioinformatically predicted

Overview

Name   vraS   Type   Regulator
Locus tag   FP482_RS09965 Genome accession   NZ_CP042153
Coordinates   2010953..2011996 (-) Length   347 a.a.
NCBI ID   WP_001017131.1    Uniprot ID   A0A0D1IMN4
Organism   Staphylococcus aureus strain B4-59C     
Function   repress expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1974271..2035344 2010953..2011996 within 0


Gene organization within MGE regions


Location: 1974271..2035344
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FP482_RS09760 (FP482_09755) perR 1974859..1975305 (-) 447 WP_000110007.1 peroxide-responsive transcriptional repressor PerR -
  FP482_RS09765 (FP482_09760) - 1975402..1976352 (-) 951 WP_000869446.1 phosphoglycerate dehydrogenase -
  FP482_RS09770 (FP482_09765) bcp 1976358..1976813 (-) 456 WP_000939521.1 thioredoxin-dependent thiol peroxidase -
  FP482_RS09775 (FP482_09770) - 1976894..1978183 (+) 1290 WP_001011595.1 glutamate-1-semialdehyde 2,1-aminomutase -
  FP482_RS09780 (FP482_09775) - 1978476..1979570 (+) 1095 WP_001236371.1 aromatic acid exporter family protein -
  FP482_RS09785 (FP482_09780) - 1979660..1979751 (-) 92 Protein_1855 hypothetical protein -
  FP482_RS09790 (FP482_09785) - 1979760..1981496 (-) 1737 WP_000597238.1 SAV1866 family putative multidrug efflux ABC transporter -
  FP482_RS09795 (FP482_09790) - 1981787..1982329 (-) 543 WP_000251253.1 DUF402 domain-containing protein -
  FP482_RS09800 (FP482_09795) mutY 1982632..1983669 (-) 1038 WP_000284765.1 A/G-specific adenine glycosylase -
  FP482_RS09805 (FP482_09800) - 1983821..1984798 (+) 978 WP_000379098.1 metal-dependent hydrolase -
  FP482_RS09815 (FP482_09810) - 1985059..1985895 (-) 837 WP_000886462.1 membrane protein -
  FP482_RS09820 (FP482_09815) - 1985904..1987421 (-) 1518 WP_000535834.1 ABC transporter ATP-binding protein -
  FP482_RS09825 (FP482_09820) - 1987436..1987750 (-) 315 WP_000435806.1 YfhH family protein -
  FP482_RS09830 (FP482_09825) recX 1987728..1988546 (-) 819 WP_001124422.1 recombination regulator RecX -
  FP482_RS09835 (FP482_09830) sgtB 1988806..1989615 (-) 810 WP_000830380.1 monofunctional peptidoglycan glycosyltransferase SgtB -
  FP482_RS09840 (FP482_09835) - 1989955..1990470 (-) 516 WP_000163283.1 type 1 glutamine amidotransferase domain-containing protein -
  FP482_RS09845 (FP482_09840) - 1990601..1990762 (-) 162 WP_001005407.1 SE1561 family protein -
  FP482_RS09850 (FP482_09845) yfkAB 1990986..1992137 (+) 1152 WP_001089621.1 radical SAM/CxCxxxxC motif protein YfkAB -
  FP482_RS09855 (FP482_09850) - 1992260..1992544 (+) 285 WP_145411588.1 hypothetical protein -
  FP482_RS09860 (FP482_09855) - 1992694..1993014 (+) 321 WP_000805733.1 DUF961 family protein -
  FP482_RS09865 (FP482_09860) - 1993028..1993330 (+) 303 WP_000386891.1 hypothetical protein -
  FP482_RS09870 (FP482_09865) - 1993505..1994596 (+) 1092 WP_000172943.1 replication initiation factor domain-containing protein -
  FP482_RS09875 (FP482_09870) - 1994657..1995712 (+) 1056 WP_000692002.1 conjugal transfer protein -
  FP482_RS09880 (FP482_09875) - 1995717..1995977 (+) 261 WP_000015639.1 TcpD family membrane protein -
  FP482_RS09885 (FP482_09880) - 1995989..1996372 (+) 384 WP_000358144.1 TcpE family conjugal transfer membrane protein -
  FP482_RS09890 (FP482_09885) - 1996407..1998902 (+) 2496 WP_145411589.1 ATP-binding protein -
  FP482_RS09895 (FP482_09890) - 1998956..2000314 (+) 1359 WP_001251209.1 FtsK/SpoIIIE domain-containing protein -
  FP482_RS09900 (FP482_09895) - 2000319..2002166 (+) 1848 WP_000681156.1 CD3337/EF1877 family mobilome membrane protein -
  FP482_RS09905 (FP482_09900) - 2002156..2003203 (+) 1048 Protein_1878 CHAP domain-containing protein -
  FP482_RS09910 (FP482_09905) - 2003210..2003800 (+) 591 WP_000810443.1 hypothetical protein -
  FP482_RS09915 (FP482_09910) - 2003856..2004212 (+) 357 WP_001255379.1 cystatin-like fold lipoprotein -
  FP482_RS09920 (FP482_09915) - 2004321..2004824 (+) 504 WP_000746373.1 transposase -
  FP482_RS09925 (FP482_09920) - 2004853..2005341 (+) 489 WP_142377520.1 IS30 family transposase -
  FP482_RS09930 (FP482_09925) - 2005754..2006284 (-) 531 WP_000184383.1 acyl-CoA thioesterase -
  FP482_RS09935 (FP482_09930) - 2006374..2007630 (-) 1257 WP_001795108.1 aminopeptidase -
  FP482_RS09940 (FP482_09935) - 2007633..2007833 (-) 201 WP_000180460.1 DUF1128 family protein -
  FP482_RS09945 (FP482_09940) - 2007980..2008444 (+) 465 WP_000228666.1 low molecular weight protein-tyrosine-phosphatase -
  FP482_RS09950 (FP482_09945) - 2008451..2008726 (+) 276 WP_000428172.1 YtxH domain-containing protein -
  FP482_RS09955 (FP482_09950) - 2009004..2010221 (+) 1218 WP_000037075.1 YihY/virulence factor BrkB family protein -
  FP482_RS09960 (FP482_09955) vraR 2010334..2010963 (-) 630 WP_000153535.1 two-component system response regulator VraR Regulator
  FP482_RS09965 (FP482_09960) vraS 2010953..2011996 (-) 1044 WP_001017131.1 sensor histidine kinase Regulator
  FP482_RS09970 (FP482_09965) liaF 2011993..2012694 (-) 702 WP_000149064.1 cell wall-active antibiotics response protein LiaF -
  FP482_RS09975 (FP482_09970) - 2012709..2013095 (-) 387 WP_001110179.1 hypothetical protein -
  FP482_RS09980 (FP482_09975) map 2013312..2014070 (-) 759 WP_000636142.1 type I methionyl aminopeptidase -
  FP482_RS09985 (FP482_09980) - 2014601..2015587 (+) 987 WP_000999717.1 aromatic acid exporter family protein -
  FP482_RS09990 (FP482_09985) - 2016018..2016431 (-) 414 WP_001557448.1 hypothetical protein -
  FP482_RS09995 (FP482_09990) - 2016460..2016570 (-) 111 WP_001790257.1 hypothetical protein -
  FP482_RS10000 (FP482_09995) - 2016656..2017387 (-) 732 WP_000544969.1 type 1 glutamine amidotransferase -
  FP482_RS10005 (FP482_10000) murT 2017389..2018702 (-) 1314 WP_001250343.1 lipid II isoglutaminyl synthase subunit MurT -
  FP482_RS10010 (FP482_10005) ftnA 2018994..2019494 (+) 501 WP_000949467.1 H-type ferritin FtnA -
  FP482_RS10015 (FP482_10010) - 2019576..2019668 (-) 93 WP_001790679.1 hypothetical protein -
  FP482_RS10020 (FP482_10015) - 2019883..2020437 (+) 555 WP_000613738.1 3'-5' exonuclease -
  FP482_RS10025 (FP482_10020) dinB 2020505..2021575 (-) 1071 WP_000140172.1 DNA polymerase IV -
  FP482_RS10030 (FP482_10025) - 2021822..2022352 (-) 531 WP_000548781.1 DUF3267 domain-containing protein -
  FP482_RS10035 (FP482_10030) rlmD 2022522..2023883 (-) 1362 WP_001147865.1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD -
  FP482_RS10040 (FP482_10035) - 2023964..2024911 (-) 948 WP_001231451.1 diacylglycerol kinase -
  FP482_RS10045 (FP482_10040) - 2025437..2025583 (-) 147 WP_001789566.1 hypothetical protein -
  FP482_RS10050 (FP482_10045) gatB 2025623..2027050 (-) 1428 WP_000545370.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB -
  FP482_RS10055 (FP482_10050) gatA 2027063..2028520 (-) 1458 WP_000027917.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA -
  FP482_RS10060 (FP482_10055) gatC 2028522..2028824 (-) 303 WP_000170162.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC -
  FP482_RS10065 (FP482_10060) putP 2029191..2030729 (+) 1539 WP_000957020.1 sodium/proline symporter PutP -
  FP482_RS10070 (FP482_10065) - 2030818..2032017 (-) 1200 WP_000831700.1 CamS family sex pheromone protein -
  FP482_RS10075 (FP482_10070) ligA 2032030..2034033 (-) 2004 WP_000774556.1 NAD-dependent DNA ligase LigA -

Sequence

Protein


Download         Length: 347 a.a.        Molecular weight: 40044.52 Da        Isoelectric Point: 6.0577

>NTDB_id=375753 FP482_RS09965 WP_001017131.1 2010953..2011996(-) (vraS) [Staphylococcus aureus strain B4-59C]
MNHYIRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLCIIVGSVLAYKINQQNDWIKT
QIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHKLRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVS
QQLFAASMMLSAIKETKLEPPLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI
QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEKLEQSYGLKNMRERALEIGAT
FHIVSLPDSGTRIEVKAPLNKEDSYDD

Nucleotide


Download         Length: 1044 bp        

>NTDB_id=375753 FP482_RS09965 WP_001017131.1 2010953..2011996(-) (vraS) [Staphylococcus aureus strain B4-59C]
ATGAACCACTACATTAGAACAATTGGTTCAATGCTCATCTTAGTATATAGCATGCTAGCTGCATTTCTATTCATCGATAA
AGTTTTTGTAAATATCATCTATTTTCAAGGTATGTTTTATACACAAATATTCGGAATACCAGTCTTTTTATTTTTAAATC
TCATCATCATATTATTGTGTATTATTGTTGGTTCGGTACTCGCATACAAAATCAATCAGCAAAATGATTGGATTAAGACG
CAAATTGAGCGTTCAATGGAAGGCGAAACAGTTGGCATTAATGATCAAAATATAGAAATATATAGTGAAACGTTAGATTT
ATACCATACACTCGTACCTTTAAATCAAGAATTGCATAAGTTGCGACTTAAAACTCAAAACTTAACCAATGAAAATTATA
ATATTAATGATGTGAAAGTTAAAAAGATTATTGAAGATGAACGTCAAAGACTAGCTCGAGAACTTCACGATTCTGTTAGT
CAGCAACTTTTTGCGGCAAGTATGATGCTTTCTGCTATCAAAGAAACGAAGTTAGAACCACCATTAGACCAACAAATTCC
GATTTTAGAGAAAATGGTTCAAGATTCGCAGTTAGAAATGCGTGCTTTGCTGTTACATTTAAGACCGCTTGGTTTAAAAG
ACAAATCTTTAGGTGAGGGTATTAAAGATTTAGTTATTGATTTACAAAAAAAAGTGCCAATGAAAGTTGTGCATGAAATA
CAAGATTTTAAAGTGCCTAAAGGTATTGAAGATCATTTGTTCAGAATTACACAGGAAGCAATTTCGAATACATTGCGTCA
TTCAAACGGTACAAAAGTGACAGTAGAATTGTTTAATAAAGACGATTATTTATTGTTGAGAATTCAAGATAATGGTAAAG
GTTTTAATGTTGATGAAAAATTAGAACAAAGTTATGGACTTAAAAATATGCGTGAAAGAGCTTTGGAAATTGGTGCAACG
TTCCATATTGTATCATTGCCAGATTCAGGTACACGTATCGAGGTGAAAGCACCTTTAAATAAGGAGGATTCGTATGACGA
TTAA

Domains

Predicted by InterproScan.

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (HATPase_c)

(249-340)

Histidine kinase (HisKA_3)

(147-210)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A0D1IMN4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  vraS Staphylococcus aureus N315

100

100

1

Multiple sequence alignment