Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   FOV14_RS14715 Genome accession   NZ_CP041784
Coordinates   3022446..3022586 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain IM1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3017446..3027586
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FOV14_RS14690 (FOV14_14815) - 3017773..3018156 (-) 384 WP_139885447.1 hotdog fold thioesterase -
  FOV14_RS14695 (FOV14_14820) comA 3018178..3018822 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  FOV14_RS14700 (FOV14_14825) comP 3018903..3021209 (-) 2307 WP_069448952.1 sensor histidine kinase Regulator
  FOV14_RS14705 (FOV14_14830) comX 3021228..3021404 (-) 177 WP_044052947.1 competence pheromone ComX -
  FOV14_RS14710 (FOV14_14835) - 3021419..3022315 (-) 897 WP_017419425.1 polyprenyl synthetase family protein -
  FOV14_RS14715 (FOV14_14840) degQ 3022446..3022586 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  FOV14_RS14720 (FOV14_14850) - 3023052..3023393 (+) 342 WP_014305721.1 hypothetical protein -
  FOV14_RS14725 (FOV14_14855) - 3023400..3024620 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  FOV14_RS14730 (FOV14_14860) - 3024750..3026216 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  FOV14_RS14735 (FOV14_14865) - 3026234..3026785 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  FOV14_RS14740 (FOV14_14870) - 3026882..3027280 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=374321 FOV14_RS14715 WP_003152043.1 3022446..3022586(-) (degQ) [Bacillus velezensis strain IM1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=374321 FOV14_RS14715 WP_003152043.1 3022446..3022586(-) (degQ) [Bacillus velezensis strain IM1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment