Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   FOV14_RS11850 Genome accession   NZ_CP041784
Coordinates   2477582..2477848 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain IM1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2472582..2482848
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FOV14_RS11800 (FOV14_11875) sinR 2472747..2473082 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  FOV14_RS11805 (FOV14_11880) - 2473130..2473915 (-) 786 WP_003153102.1 TasA family protein -
  FOV14_RS11810 (FOV14_11885) - 2473979..2474563 (-) 585 WP_240679749.1 signal peptidase I -
  FOV14_RS11815 (FOV14_11890) tapA 2474535..2475206 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  FOV14_RS11820 (FOV14_11895) - 2475465..2475794 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  FOV14_RS11825 (FOV14_11900) - 2475834..2476013 (-) 180 WP_003153093.1 YqzE family protein -
  FOV14_RS11830 (FOV14_11905) comGG 2476070..2476447 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  FOV14_RS11835 (FOV14_11910) comGF 2476448..2476948 (-) 501 WP_235570156.1 competence type IV pilus minor pilin ComGF -
  FOV14_RS11840 (FOV14_11915) comGE 2476857..2477171 (-) 315 WP_057080485.1 competence type IV pilus minor pilin ComGE Machinery gene
  FOV14_RS11845 (FOV14_11920) comGD 2477155..2477592 (-) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene
  FOV14_RS11850 (FOV14_11925) comGC 2477582..2477848 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  FOV14_RS11855 (FOV14_11930) comGB 2477895..2478932 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  FOV14_RS11860 (FOV14_11935) comGA 2478919..2479989 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  FOV14_RS11865 (FOV14_11940) - 2480181..2481131 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -
  FOV14_RS11870 (FOV14_11945) - 2481277..2482578 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=374304 FOV14_RS11850 WP_042635730.1 2477582..2477848(-) (comGC) [Bacillus velezensis strain IM1]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=374304 FOV14_RS11850 WP_042635730.1 2477582..2477848(-) (comGC) [Bacillus velezensis strain IM1]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602

Multiple sequence alignment