Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | FOV14_RS11795 | Genome accession | NZ_CP041784 |
| Coordinates | 2472540..2472713 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain IM1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2467540..2477713
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOV14_RS11780 (FOV14_11855) | gcvT | 2468358..2469458 (-) | 1101 | WP_014305405.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| FOV14_RS11785 (FOV14_11860) | - | 2469881..2471551 (+) | 1671 | WP_003153107.1 | SNF2-related protein | - |
| FOV14_RS11790 (FOV14_11865) | - | 2471569..2472363 (+) | 795 | WP_240679748.1 | YqhG family protein | - |
| FOV14_RS11795 (FOV14_11870) | sinI | 2472540..2472713 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| FOV14_RS11800 (FOV14_11875) | sinR | 2472747..2473082 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| FOV14_RS11805 (FOV14_11880) | - | 2473130..2473915 (-) | 786 | WP_003153102.1 | TasA family protein | - |
| FOV14_RS11810 (FOV14_11885) | - | 2473979..2474563 (-) | 585 | WP_240679749.1 | signal peptidase I | - |
| FOV14_RS11815 (FOV14_11890) | tapA | 2474535..2475206 (-) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| FOV14_RS11820 (FOV14_11895) | - | 2475465..2475794 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| FOV14_RS11825 (FOV14_11900) | - | 2475834..2476013 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| FOV14_RS11830 (FOV14_11905) | comGG | 2476070..2476447 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| FOV14_RS11835 (FOV14_11910) | comGF | 2476448..2476948 (-) | 501 | WP_235570156.1 | competence type IV pilus minor pilin ComGF | - |
| FOV14_RS11840 (FOV14_11915) | comGE | 2476857..2477171 (-) | 315 | WP_057080485.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| FOV14_RS11845 (FOV14_11920) | comGD | 2477155..2477592 (-) | 438 | WP_015388002.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=374299 FOV14_RS11795 WP_003153105.1 2472540..2472713(+) (sinI) [Bacillus velezensis strain IM1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=374299 FOV14_RS11795 WP_003153105.1 2472540..2472713(+) (sinI) [Bacillus velezensis strain IM1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |