Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | FNS63_RS06175 | Genome accession | NZ_CP041770 |
| Coordinates | 1354685..1354858 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain DH8030 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1349685..1359858
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FNS63_RS06160 (FNS63_06155) | gcvT | 1350503..1351603 (-) | 1101 | WP_024085597.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| FNS63_RS06165 (FNS63_06160) | - | 1352026..1353696 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| FNS63_RS06170 (FNS63_06165) | - | 1353714..1354508 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| FNS63_RS06175 (FNS63_06170) | sinI | 1354685..1354858 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| FNS63_RS06180 (FNS63_06175) | sinR | 1354892..1355227 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| FNS63_RS06185 (FNS63_06180) | tasA | 1355275..1356060 (-) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| FNS63_RS06190 (FNS63_06185) | sipW | 1356124..1356708 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| FNS63_RS06195 (FNS63_06190) | tapA | 1356680..1357351 (-) | 672 | WP_024085598.1 | amyloid fiber anchoring/assembly protein TapA | - |
| FNS63_RS06200 (FNS63_06195) | - | 1357611..1357940 (+) | 330 | WP_024085599.1 | DUF3889 domain-containing protein | - |
| FNS63_RS06205 (FNS63_06200) | - | 1357980..1358159 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| FNS63_RS06210 (FNS63_06205) | comGG | 1358216..1358593 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| FNS63_RS06215 (FNS63_06210) | comGF | 1358594..1359094 (-) | 501 | WP_223203779.1 | competence type IV pilus minor pilin ComGF | - |
| FNS63_RS06220 (FNS63_06215) | comGE | 1359003..1359317 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| FNS63_RS06225 (FNS63_06220) | comGD | 1359301..1359738 (-) | 438 | WP_024085600.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=374005 FNS63_RS06175 WP_003153105.1 1354685..1354858(+) (sinI) [Bacillus amyloliquefaciens strain DH8030]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=374005 FNS63_RS06175 WP_003153105.1 1354685..1354858(+) (sinI) [Bacillus amyloliquefaciens strain DH8030]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |