Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   FFE90_RS13435 Genome accession   NZ_CP041757
Coordinates   2552035..2552208 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. KBS0812     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2547035..2557208
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FFE90_RS13420 (FFE90_013420) gcvT 2547834..2548922 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  FFE90_RS13425 (FFE90_013425) - 2549364..2551037 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  FFE90_RS13430 (FFE90_013430) - 2551058..2551852 (+) 795 WP_003230200.1 YqhG family protein -
  FFE90_RS13435 (FFE90_013435) sinI 2552035..2552208 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  FFE90_RS13440 (FFE90_013440) sinR 2552242..2552577 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  FFE90_RS13445 (FFE90_013445) tasA 2552670..2553455 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  FFE90_RS13450 (FFE90_013450) sipW 2553519..2554091 (-) 573 WP_003246088.1 signal peptidase I SipW -
  FFE90_RS13455 (FFE90_013455) tapA 2554075..2554836 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  FFE90_RS13460 (FFE90_013460) - 2555108..2555434 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  FFE90_RS13465 (FFE90_013465) - 2555476..2555655 (-) 180 WP_003230176.1 YqzE family protein -
  FFE90_RS13470 (FFE90_013470) comGG 2555726..2556100 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  FFE90_RS13475 (FFE90_013475) comGF 2556101..2556484 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  FFE90_RS13480 (FFE90_013480) comGE 2556510..2556857 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=373817 FFE90_RS13435 WP_003230187.1 2552035..2552208(+) (sinI) [Bacillus sp. KBS0812]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=373817 FFE90_RS13435 WP_003230187.1 2552035..2552208(+) (sinI) [Bacillus sp. KBS0812]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment