Detailed information
Bioinformatically predicted
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | FNL98_RS08740 | Genome accession | NZ_CP041585 |
| Coordinates | 1505397..1505870 (-) | Length | 157 a.a. |
| NCBI ID | WP_025455870.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain NJ1711654 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1453246..1515699 | 1505397..1505870 | within | 0 |
Gene organization within MGE regions
Location: 1453246..1515699
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FNL98_RS08365 (FNL98_08365) | - | 1453246..1453899 (-) | 654 | WP_162855545.1 | IS1595 family transposase | - |
| FNL98_RS08370 (FNL98_08370) | purM | 1454896..1455930 (-) | 1035 | WP_003692893.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| FNL98_RS08375 (FNL98_08375) | - | 1456171..1456359 (+) | 189 | WP_003689039.1 | hypothetical protein | - |
| FNL98_RS08380 (FNL98_08380) | - | 1456619..1457608 (+) | 990 | WP_003689040.1 | site-specific integrase | - |
| FNL98_RS08390 (FNL98_08390) | - | 1457950..1458429 (+) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| FNL98_RS08395 (FNL98_08395) | - | 1458489..1461533 (-) | 3045 | WP_103195301.1 | tape measure protein | - |
| FNL98_RS08410 (FNL98_08410) | - | 1462210..1462551 (-) | 342 | WP_003696082.1 | hypothetical protein | - |
| FNL98_RS13305 | - | 1462535..1462693 (-) | 159 | WP_003691816.1 | hypothetical protein | - |
| FNL98_RS08415 (FNL98_08415) | - | 1462693..1463232 (-) | 540 | WP_103195302.1 | TIGR02594 family protein | - |
| FNL98_RS13880 | - | 1463274..1463399 (-) | 126 | WP_255294325.1 | hypothetical protein | - |
| FNL98_RS08425 (FNL98_08425) | - | 1463439..1463675 (+) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| FNL98_RS08430 (FNL98_08430) | - | 1463675..1464022 (+) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| FNL98_RS08435 (FNL98_08435) | - | 1464030..1464263 (+) | 234 | WP_003692884.1 | hypothetical protein | - |
| FNL98_RS08440 (FNL98_08440) | - | 1464391..1464723 (-) | 333 | WP_003691408.1 | hypothetical protein | - |
| FNL98_RS08445 (FNL98_08445) | - | 1464724..1465194 (-) | 471 | WP_003691410.1 | hypothetical protein | - |
| FNL98_RS08450 (FNL98_08450) | - | 1465265..1465570 (-) | 306 | WP_003689058.1 | hypothetical protein | - |
| FNL98_RS08455 (FNL98_08455) | - | 1465682..1469827 (-) | 4146 | WP_125121574.1 | phage tail protein | - |
| FNL98_RS08460 (FNL98_08460) | - | 1470067..1470345 (+) | 279 | WP_003689062.1 | helix-turn-helix domain-containing protein | - |
| FNL98_RS08465 (FNL98_08465) | - | 1470373..1470804 (-) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| FNL98_RS08470 (FNL98_08470) | - | 1470806..1471660 (-) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| FNL98_RS08475 (FNL98_08475) | - | 1471657..1472256 (-) | 600 | WP_003692874.1 | DUF2460 domain-containing protein | - |
| FNL98_RS08480 (FNL98_08480) | - | 1472256..1472522 (-) | 267 | WP_003689070.1 | hypothetical protein | - |
| FNL98_RS08485 (FNL98_08485) | - | 1472534..1472863 (-) | 330 | WP_003692871.1 | hypothetical protein | - |
| FNL98_RS08490 (FNL98_08490) | - | 1472924..1473697 (-) | 774 | WP_003692869.1 | hypothetical protein | - |
| FNL98_RS08495 (FNL98_08495) | - | 1473723..1474151 (-) | 429 | WP_003689076.1 | hypothetical protein | - |
| FNL98_RS08500 (FNL98_08500) | - | 1474148..1474630 (-) | 483 | WP_041421297.1 | HK97 gp10 family phage protein | - |
| FNL98_RS08505 (FNL98_08505) | - | 1474630..1475160 (-) | 531 | WP_003689080.1 | head-tail connector protein | - |
| FNL98_RS08510 (FNL98_08510) | - | 1475163..1475519 (-) | 357 | WP_003691418.1 | hypothetical protein | - |
| FNL98_RS08515 (FNL98_08515) | - | 1475526..1477025 (-) | 1500 | WP_003691419.1 | hypothetical protein | - |
| FNL98_RS08520 (FNL98_08520) | - | 1477066..1478223 (-) | 1158 | WP_047918052.1 | HK97 family phage prohead protease | - |
| FNL98_RS08525 (FNL98_08525) | - | 1478291..1480438 (-) | 2148 | WP_003691423.1 | phage portal protein | - |
| FNL98_RS08530 (FNL98_08530) | terL | 1480435..1481856 (-) | 1422 | WP_003697216.1 | phage terminase large subunit | - |
| FNL98_RS08535 (FNL98_08535) | - | 1481918..1482367 (-) | 450 | WP_003695485.1 | hypothetical protein | - |
| FNL98_RS08540 (FNL98_08540) | - | 1482660..1483529 (-) | 870 | WP_103195306.1 | BRO family protein | - |
| FNL98_RS08545 (FNL98_08545) | - | 1483810..1484970 (-) | 1161 | WP_047919575.1 | type I restriction endonuclease | - |
| FNL98_RS08550 (FNL98_08550) | - | 1485061..1485468 (-) | 408 | WP_103195307.1 | hypothetical protein | - |
| FNL98_RS13885 | - | 1485590..1485718 (+) | 129 | WP_012503747.1 | hypothetical protein | - |
| FNL98_RS08560 (FNL98_08560) | - | 1485735..1486115 (-) | 381 | WP_048596749.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FNL98_RS13890 | - | 1486106..1486387 (-) | 282 | WP_003689109.1 | hypothetical protein | - |
| FNL98_RS08565 (FNL98_08565) | - | 1486416..1486565 (-) | 150 | WP_003689110.1 | hypothetical protein | - |
| FNL98_RS08570 (FNL98_08570) | - | 1486742..1487236 (-) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| FNL98_RS08575 (FNL98_08575) | - | 1487275..1487481 (-) | 207 | WP_154235934.1 | hypothetical protein | - |
| FNL98_RS08580 (FNL98_08580) | - | 1487575..1488936 (-) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| FNL98_RS13895 | - | 1488933..1489436 (-) | 504 | WP_010360005.1 | hypothetical protein | - |
| FNL98_RS13310 | - | 1489981..1490118 (-) | 138 | WP_010359998.1 | hypothetical protein | - |
| FNL98_RS08590 (FNL98_08590) | - | 1490115..1490342 (-) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| FNL98_RS08595 (FNL98_08595) | - | 1490515..1490703 (+) | 189 | WP_003691445.1 | hypothetical protein | - |
| FNL98_RS08600 (FNL98_08600) | - | 1490680..1490835 (-) | 156 | WP_003689578.1 | hypothetical protein | - |
| FNL98_RS08605 (FNL98_08605) | - | 1490915..1491145 (-) | 231 | WP_020997318.1 | Cro/CI family transcriptional regulator | - |
| FNL98_RS08610 (FNL98_08610) | - | 1491274..1491936 (+) | 663 | WP_012503489.1 | LexA family transcriptional regulator | - |
| FNL98_RS08615 (FNL98_08615) | - | 1492047..1492484 (+) | 438 | WP_003687967.1 | hypothetical protein | - |
| FNL98_RS08620 (FNL98_08620) | - | 1492501..1492962 (+) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| FNL98_RS08625 (FNL98_08625) | - | 1492959..1493372 (+) | 414 | WP_003687963.1 | hypothetical protein | - |
| FNL98_RS08630 (FNL98_08630) | - | 1493570..1493770 (+) | 201 | WP_047954343.1 | hypothetical protein | - |
| FNL98_RS08635 (FNL98_08635) | - | 1493803..1494279 (+) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| FNL98_RS08640 (FNL98_08640) | - | 1494276..1494563 (+) | 288 | WP_143824043.1 | hypothetical protein | - |
| FNL98_RS08645 (FNL98_08645) | - | 1494704..1495036 (+) | 333 | WP_003687946.1 | hypothetical protein | - |
| FNL98_RS08650 (FNL98_08650) | - | 1495189..1495467 (+) | 279 | WP_003691529.1 | NGO1622 family putative holin | - |
| FNL98_RS08655 (FNL98_08655) | - | 1495464..1495625 (+) | 162 | WP_003693867.1 | hypothetical protein | - |
| FNL98_RS08660 (FNL98_08660) | - | 1495694..1496380 (+) | 687 | WP_050159915.1 | phage replication initiation protein, NGO0469 family | - |
| FNL98_RS08665 (FNL98_08665) | - | 1496520..1496702 (+) | 183 | WP_003691535.1 | hypothetical protein | - |
| FNL98_RS08670 (FNL98_08670) | - | 1496699..1497190 (+) | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| FNL98_RS08675 (FNL98_08675) | - | 1497242..1497457 (+) | 216 | WP_003691538.1 | hypothetical protein | - |
| FNL98_RS14090 | - | 1497568..1497834 (+) | 267 | Protein_1502 | hypothetical protein | - |
| FNL98_RS08685 (FNL98_08685) | - | 1498115..1498798 (+) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| FNL98_RS08690 (FNL98_08690) | - | 1498993..1499262 (+) | 270 | WP_003687928.1 | hypothetical protein | - |
| FNL98_RS08700 (FNL98_08700) | - | 1499618..1500811 (-) | 1194 | WP_010359935.1 | phage integrase central domain-containing protein | - |
| FNL98_RS08715 (FNL98_08715) | yaaA | 1501342..1502121 (-) | 780 | WP_003706583.1 | peroxide stress protein YaaA | - |
| FNL98_RS08720 (FNL98_08720) | dapC | 1502432..1503619 (-) | 1188 | WP_047949582.1 | succinyldiaminopimelate transaminase | - |
| FNL98_RS08725 (FNL98_08725) | dut | 1503697..1504149 (-) | 453 | WP_103195211.1 | dUTP diphosphatase | - |
| FNL98_RS08730 (FNL98_08730) | - | 1504315..1505022 (+) | 708 | Protein_1509 | AzlC family ABC transporter permease | - |
| FNL98_RS08735 (FNL98_08735) | - | 1505019..1505327 (+) | 309 | WP_010951048.1 | AzlD family protein | - |
| FNL98_RS08740 (FNL98_08740) | pilL | 1505397..1505870 (-) | 474 | WP_025455870.1 | PilX family type IV pilin | Machinery gene |
| FNL98_RS08745 (FNL98_08745) | pilK | 1505872..1506483 (-) | 612 | WP_003687918.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| FNL98_RS08750 (FNL98_08750) | pilJ | 1506462..1507442 (-) | 981 | WP_010951046.1 | PilW family protein | Machinery gene |
| FNL98_RS08755 (FNL98_08755) | pilV | 1507439..1508050 (-) | 612 | WP_050169631.1 | type IV pilus modification protein PilV | Machinery gene |
| FNL98_RS08760 (FNL98_08760) | pilH | 1508082..1508747 (-) | 666 | WP_047918678.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| FNL98_RS08765 (FNL98_08765) | dnaB | 1508902..1510308 (-) | 1407 | WP_047917169.1 | replicative DNA helicase | - |
| FNL98_RS08775 (FNL98_08775) | - | 1510472..1511053 (+) | 582 | WP_047923823.1 | superoxide dismutase | - |
| FNL98_RS08785 (FNL98_08785) | - | 1511285..1511794 (-) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| FNL98_RS08790 (FNL98_08790) | - | 1512125..1512457 (-) | 333 | WP_003687908.1 | hypothetical protein | - |
| FNL98_RS08795 (FNL98_08795) | cysT | 1512643..1513472 (+) | 830 | Protein_1520 | sulfate ABC transporter permease subunit CysT | - |
| FNL98_RS08800 (FNL98_08800) | cysW | 1513661..1514482 (+) | 822 | WP_103195209.1 | sulfate ABC transporter permease subunit CysW | - |
| FNL98_RS08805 (FNL98_08805) | - | 1514466..1514600 (+) | 135 | Protein_1522 | IS5/IS1182 family transposase | - |
| FNL98_RS08810 (FNL98_08810) | - | 1514623..1515699 (+) | 1077 | WP_003687905.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17555.36 Da Isoelectric Point: 9.4067
>NTDB_id=372348 FNL98_RS08740 WP_025455870.1 1505397..1505870(-) (pilL) [Neisseria gonorrhoeae strain NJ1711654]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDILKSKLEIFVSGYKM
NPKIAKKYSVSVRFVDAEKPRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRDATSAQVYLETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDILKSKLEIFVSGYKM
NPKIAKKYSVSVRFVDAEKPRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRDATSAQVYLETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=372348 FNL98_RS08740 WP_025455870.1 1505397..1505870(-) (pilL) [Neisseria gonorrhoeae strain NJ1711654]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATATCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAGGTTTGTCGATGCGGAAAAACCAAGGGCATACAGGTTGGTCGG
TGTTCCGAACGCGGGGACGGGTTATACTTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCA
CTTCTGCCCAGGTCTATTTGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATATCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAGGTTTGTCGATGCGGAAAAACCAAGGGCATACAGGTTGGTCGG
TGTTCCGAACGCGGGGACGGGTTATACTTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCA
CTTCTGCCCAGGTCTATTTGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| pilX | Neisseria meningitidis 8013 |
85.987 |
100 |
0.86 |