Detailed information NTG0371949

Bioinformatically predicted

Overview

• Name: comGG
• Type: Machinery gene
• Locus tag: ST64987_RS08875
• Genome accession: NZ_CP049053
• Coordinates: 1684300..1684617 (-)
• Length: 105 a.a.
• NCBI ID: WP_011681685.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain ST64987
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1679300..1689617

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ST64987_RS08840 (ST64987_1691)	-	1679659..1680321 (-)	663	WP_011681679.1	CPBP family intramembrane glutamic endopeptidase	-
ST64987_RS08845 (ST64987_1692)	-	1680418..1680861 (-)	444	WP_011681680.1	hypothetical protein	-
ST64987_RS10400 (ST64987_1693)	-	1680935..1681360 (-)	426	WP_014608739.1	CPBP family intramembrane glutamic endopeptidase	-
ST64987_RS10405 (ST64987_1694)	-	1681317..1681592 (-)	276	WP_011681681.1	hypothetical protein	-
ST64987_RS08860 (ST64987_1695)	-	1681604..1681801 (-)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
ST64987_RS08865 (ST64987_1696)	-	1682050..1683243 (-)	1194	WP_014608740.1	acetate kinase	-
ST64987_RS08870 (ST64987_1697)	comGH	1683299..1684255 (-)	957	WP_011681684.1	class I SAM-dependent methyltransferase	Machinery gene
ST64987_RS08875 (ST64987_1698)	comGG	1684300..1684617 (-)	318	WP_011681685.1	competence type IV pilus minor pilin ComGG	Machinery gene
ST64987_RS08880 (ST64987_1699)	comGF	1684595..1685032 (-)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
ST64987_RS08885 (ST64987_1700)	comGE	1685016..1685309 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	Machinery gene
ST64987_RS08890 (ST64987_1701)	comGD	1685281..1685709 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
ST64987_RS08895 (ST64987_1702)	comGC	1685669..1685995 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
ST64987_RS08900 (ST64987_1703)	comGB	1685992..1687092 (-)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
ST64987_RS08905 (ST64987_1704)	comGA/cglA/cilD	1686974..1687915 (-)	942	WP_014608745.1	competence type IV pilus ATPase ComGA	Machinery gene
ST64987_RS08910 (ST64987_1705)	-	1687996..1688358 (-)	363	WP_167401603.1	DUF1033 family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11851.01 Da
• Isoelectric Point: 10.6334

>NTDB_id=371949 ST64987_RS08875 WP_011681685.1 1684300..1684617(-) (comGG) [Streptococcus thermophilus strain ST64987]
MLLKKQVRGGVLLYALFMAGIFILLLQVYLERVVASSRQNQAQIVASQSRLMAEMTMDLVDKEAGAFSFSQGTTTYEVKG
KQVVVRVVSKGQIKTYRYVKKQDQK

Nucleotide

• Length: 318 bp

>NTDB_id=371949 ST64987_RS08875 WP_011681685.1 1684300..1684617(-) (comGG) [Streptococcus thermophilus strain ST64987]
ATGCTTTTGAAAAAACAGGTTAGGGGAGGCGTTCTTCTCTACGCTCTTTTTATGGCTGGCATTTTTATACTCCTTCTTCA
GGTTTATCTGGAACGGGTGGTAGCTAGCTCTAGACAAAACCAAGCGCAAATAGTGGCCAGTCAAAGCCGTCTCATGGCAG
AGATGACTATGGACTTGGTGGATAAGGAAGCAGGTGCTTTTAGTTTTTCTCAGGGGACTACGACTTACGAGGTTAAGGGT
AAGCAAGTGGTTGTCAGAGTTGTCAGTAAAGGCCAAATCAAGACCTATCGTTATGTGAAGAAACAAGATCAGAAATAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG	Streptococcus mutans UA140	45.455	94.286	0.429
comGG	Streptococcus mutans UA159	45.455	94.286	0.429
comGG/cglG	Streptococcus pneumoniae Rx1	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae TIGR4	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae D39	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae R6	43.333	85.714	0.371
comGG/cglG	Streptococcus mitis NCTC 12261	42.222	85.714	0.362