Detailed information
Overview
| Name | vicX | Type | Regulator |
| Locus tag | FNL90_RS02405 | Genome accession | NZ_CP041408 |
| Coordinates | 453860..454669 (+) | Length | 269 a.a. |
| NCBI ID | WP_023612763.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 37-97S | ||
| Function | require for competence development (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 404334..476749 | 453860..454669 | within | 0 |
Gene organization within MGE regions
Location: 404334..476749
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FNL90_RS09975 (FNL90_02210) | - | 404543..404854 (+) | 312 | WP_227874480.1 | CPBP family intramembrane glutamic endopeptidase | - |
| FNL90_RS09710 | - | 404939..405067 (+) | 129 | WP_002994583.1 | hypothetical protein | - |
| FNL90_RS02140 (FNL90_02215) | - | 405465..405692 (+) | 228 | WP_028797129.1 | Blp family class II bacteriocin | - |
| FNL90_RS02145 (FNL90_02220) | - | 405741..406058 (+) | 318 | WP_002994587.1 | hypothetical protein | - |
| FNL90_RS09715 | - | 406178..407262 (+) | 1085 | Protein_376 | IS3 family transposase | - |
| FNL90_RS02165 (FNL90_02240) | - | 407466..408864 (+) | 1399 | Protein_377 | IS1182 family transposase | - |
| FNL90_RS02170 (FNL90_02245) | comE/blpR | 409112..409861 (+) | 750 | WP_002992578.1 | response regulator transcription factor | Regulator |
| FNL90_RS02175 (FNL90_02250) | - | 409862..411196 (+) | 1335 | WP_047235191.1 | sensor histidine kinase | - |
| FNL90_RS09890 (FNL90_02255) | - | 411344..411463 (-) | 120 | WP_185168158.1 | ComC/BlpC family leader-containing pheromone/bacteriocin | - |
| FNL90_RS02185 (FNL90_02260) | - | 411547..412911 (-) | 1365 | WP_014635340.1 | bacteriocin secretion accessory protein | - |
| FNL90_RS02190 (FNL90_02265) | comA/nlmT | 412922..415075 (-) | 2154 | WP_047235192.1 | peptide cleavage/export ABC transporter | Regulator |
| FNL90_RS02195 (FNL90_02275) | - | 415528..416214 (+) | 687 | Protein_383 | transposase | - |
| FNL90_RS02200 (FNL90_02280) | - | 416402..416659 (+) | 258 | WP_023078219.1 | Blp family class II bacteriocin | - |
| FNL90_RS02205 (FNL90_02285) | - | 416674..416856 (+) | 183 | WP_002987564.1 | class IIb bacteriocin, lactobin A/cerein 7B family | - |
| FNL90_RS02210 (FNL90_02290) | - | 417047..417733 (-) | 687 | Protein_386 | transposase | - |
| FNL90_RS02215 (FNL90_02295) | - | 418053..418280 (+) | 228 | WP_002992018.1 | Blp family class II bacteriocin | - |
| FNL90_RS02220 (FNL90_02300) | - | 418293..418493 (+) | 201 | WP_002985729.1 | class IIb bacteriocin, lactobin A/cerein 7B family | - |
| FNL90_RS09720 (FNL90_02310) | - | 418855..418983 (+) | 129 | WP_002985724.1 | hypothetical protein | - |
| FNL90_RS02225 (FNL90_02320) | - | 419509..419910 (+) | 402 | WP_047235194.1 | hypothetical protein | - |
| FNL90_RS02230 (FNL90_02325) | - | 420161..421231 (+) | 1071 | WP_047235195.1 | hypothetical protein | - |
| FNL90_RS02235 (FNL90_02330) | - | 421324..421722 (+) | 399 | WP_038433666.1 | hypothetical protein | - |
| FNL90_RS02240 (FNL90_02335) | stcA | 422070..422339 (-) | 270 | WP_011017467.1 | quorum-sensing system protein StcA | - |
| FNL90_RS02245 | - | 422734..422913 (-) | 180 | WP_011184266.1 | hypothetical protein | - |
| FNL90_RS09895 (FNL90_02340) | - | 422862..423104 (-) | 243 | WP_002985713.1 | hypothetical protein | - |
| FNL90_RS02250 (FNL90_02345) | shp2 | 423254..423322 (-) | 69 | WP_128650799.1 | peptide pheromone SHP2 | - |
| FNL90_RS02255 (FNL90_02350) | rgg2 | 423411..424277 (+) | 867 | WP_002990747.1 | quorum-sensing system transcriptional regulator Rgg2 | - |
| FNL90_RS02260 (FNL90_02355) | mutM | 424449..425276 (+) | 828 | WP_002990742.1 | DNA-formamidopyrimidine glycosylase | - |
| FNL90_RS02265 (FNL90_02360) | coaE | 425273..425866 (+) | 594 | WP_047235583.1 | dephospho-CoA kinase | - |
| FNL90_RS02270 (FNL90_02365) | - | 426066..427568 (+) | 1503 | WP_047235196.1 | helicase HerA-like domain-containing protein | - |
| FNL90_RS02275 (FNL90_02370) | - | 427690..428883 (+) | 1194 | WP_002994146.1 | multidrug efflux MFS transporter | - |
| FNL90_RS02280 (FNL90_02375) | rpmG | 428880..429026 (+) | 147 | WP_002990729.1 | 50S ribosomal protein L33 | - |
| FNL90_RS02285 (FNL90_02380) | secG | 429072..429308 (+) | 237 | WP_047235197.1 | preprotein translocase subunit SecG | - |
| FNL90_RS02290 (FNL90_02385) | rnr | 429402..431735 (+) | 2334 | WP_080342657.1 | ribonuclease R | - |
| FNL90_RS02295 (FNL90_02390) | smpB | 431738..432205 (+) | 468 | WP_047235198.1 | SsrA-binding protein SmpB | - |
| FNL90_RS02300 (FNL90_02395) | - | 432211..432930 (+) | 720 | WP_010921981.1 | glutaminyl-peptide cyclotransferase | - |
| FNL90_RS02305 (FNL90_02400) | pcp | 433048..433695 (-) | 648 | WP_047235199.1 | pyroglutamyl-peptidase I | - |
| FNL90_RS02310 (FNL90_02405) | - | 433745..434671 (-) | 927 | WP_011184272.1 | DUF979 domain-containing protein | - |
| FNL90_RS02315 (FNL90_02410) | - | 434671..435354 (-) | 684 | WP_014635345.1 | DUF969 domain-containing protein | - |
| FNL90_RS02320 (FNL90_02415) | - | 435565..436491 (-) | 927 | WP_002994177.1 | glycosyltransferase family 2 protein | - |
| FNL90_RS02325 (FNL90_02420) | - | 436636..437013 (-) | 378 | WP_002985686.1 | VOC family protein | - |
| FNL90_RS02330 (FNL90_02425) | - | 437024..437689 (-) | 666 | WP_002985684.1 | NAD(P)H-dependent oxidoreductase | - |
| FNL90_RS02335 (FNL90_02430) | - | 437738..438823 (-) | 1086 | WP_011054264.1 | aminopeptidase P family protein | - |
| FNL90_RS02340 (FNL90_02435) | ccpA | 438997..439998 (+) | 1002 | WP_002985680.1 | catabolite control protein A | Regulator |
| FNL90_RS02345 (FNL90_02440) | - | 440129..441127 (+) | 999 | WP_002985678.1 | glycosyltransferase family 4 protein | - |
| FNL90_RS02350 (FNL90_02445) | - | 441129..442463 (+) | 1335 | WP_002985676.1 | glycosyltransferase family 4 protein | - |
| FNL90_RS02355 (FNL90_02450) | thrS | 442885..444828 (+) | 1944 | WP_047235200.1 | threonine--tRNA ligase | - |
| FNL90_RS02360 (FNL90_02455) | - | 444969..445961 (+) | 993 | WP_011017482.1 | ATP-binding cassette domain-containing protein | - |
| FNL90_RS02365 (FNL90_02460) | - | 445963..446781 (+) | 819 | WP_047235201.1 | ABC-2 family transporter protein | - |
| FNL90_RS02370 (FNL90_02465) | - | 446783..447568 (+) | 786 | WP_002985667.1 | ABC transporter permease | - |
| FNL90_RS02375 (FNL90_02470) | - | 447653..447802 (+) | 150 | WP_011285429.1 | hypothetical protein | - |
| FNL90_RS02380 (FNL90_02475) | - | 448197..449345 (+) | 1149 | WP_047235202.1 | acetyl-CoA C-acyltransferase | - |
| FNL90_RS02385 (FNL90_02480) | - | 449302..450549 (+) | 1248 | WP_047235203.1 | AMP-binding protein | - |
| FNL90_RS02390 (FNL90_02485) | - | 450605..451639 (+) | 1035 | WP_174147118.1 | DUF3114 domain-containing protein | - |
| FNL90_RS02395 (FNL90_02490) | vicR | 451801..452511 (+) | 711 | WP_002985645.1 | response regulator YycF | Regulator |
| FNL90_RS02400 (FNL90_02495) | vicK | 452504..453856 (+) | 1353 | WP_014407395.1 | cell wall metabolism sensor histidine kinase VicK | Regulator |
| FNL90_RS02405 (FNL90_02500) | vicX | 453860..454669 (+) | 810 | WP_023612763.1 | MBL fold metallo-hydrolase | Regulator |
| FNL90_RS02410 (FNL90_02505) | rnc | 455088..455780 (+) | 693 | WP_002990670.1 | ribonuclease III | - |
| FNL90_RS02415 (FNL90_02510) | smc | 455781..459320 (+) | 3540 | WP_047235204.1 | chromosome segregation protein SMC | - |
| FNL90_RS02420 (FNL90_02515) | rgg3 | 459573..460424 (-) | 852 | WP_002985634.1 | quorum-sensing system transcriptional regulator Rgg3 | - |
| FNL90_RS02425 (FNL90_02520) | shp3 | 460504..460575 (+) | 72 | WP_128650800.1 | peptide pheromone SHP3 | - |
| FNL90_RS02430 (FNL90_02525) | - | 460644..461570 (+) | 927 | WP_020833336.1 | shikimate dehydrogenase | - |
| FNL90_RS02435 (FNL90_02530) | - | 461567..462403 (+) | 837 | WP_002985631.1 | sugar phosphate isomerase/epimerase | - |
| FNL90_RS02440 (FNL90_02535) | cofE | 462405..463139 (+) | 735 | WP_002994761.1 | coenzyme F420-0:L-glutamate ligase | - |
| FNL90_RS02445 (FNL90_02540) | - | 463132..464118 (+) | 987 | WP_009880286.1 | dehydrogenase | - |
| FNL90_RS02450 (FNL90_02545) | - | 464128..465327 (+) | 1200 | WP_002985626.1 | methionine adenosyltransferase | - |
| FNL90_RS02455 (FNL90_02550) | - | 465311..466279 (+) | 969 | WP_002985624.1 | serine kinase | - |
| FNL90_RS02460 (FNL90_02555) | - | 466334..467323 (+) | 990 | WP_009880288.1 | glycosyltransferase | - |
| FNL90_RS02465 (FNL90_02565) | - | 468015..469172 (+) | 1158 | WP_009880289.1 | nucleotide sugar dehydrogenase | - |
| FNL90_RS02470 (FNL90_02570) | - | 469257..470465 (+) | 1209 | WP_032464248.1 | MFS transporter | - |
| FNL90_RS02475 (FNL90_02575) | - | 470568..470777 (-) | 210 | WP_002985621.1 | helix-turn-helix transcriptional regulator | - |
| FNL90_RS02485 (FNL90_02585) | - | 470758..472425 (-) | 1668 | Protein_442 | DUF2326 domain-containing protein | - |
| FNL90_RS02490 (FNL90_02590) | - | 472416..472640 (-) | 225 | WP_001176803.1 | ABC-three component system middle component 7 | - |
| FNL90_RS02495 (FNL90_02595) | - | 472640..473533 (-) | 894 | WP_080342658.1 | ABC-three component system protein | - |
| FNL90_RS02500 (FNL90_02600) | - | 473468..473725 (+) | 258 | WP_229699512.1 | terminase TerL endonuclease subunit | - |
| FNL90_RS02505 (FNL90_02605) | - | 473780..474082 (+) | 303 | WP_002991611.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| FNL90_RS02510 (FNL90_02610) | - | 474082..474387 (+) | 306 | Protein_447 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| FNL90_RS02515 (FNL90_02615) | - | 474406..474678 (+) | 273 | WP_002985604.1 | hypothetical protein | - |
| FNL90_RS09725 | - | 474783..474917 (+) | 135 | Protein_449 | portal protein | - |
Sequence
Protein
Download Length: 269 a.a. Molecular weight: 30081.18 Da Isoelectric Point: 5.5314
>NTDB_id=371881 FNL90_RS02405 WP_023612763.1 453860..454669(+) (vicX) [Streptococcus pyogenes strain 37-97S]
MNESGFKYSILASGSTGNCFYLETPKKRLLIDAGLTGKKITSLLAEIDRKPEDLDAILITHEHSDHIKGVGVMARKYHLD
VYANEKTWQLMDECNMLGKLDASQKHIFQRDKVLTFGDVDIESFGVSHDAIDPQFYRIMKDNKSFVMLTDTGYVSDRMTG
IIENADGYLIESNHDIEILRSGSYPWSLKQRILSDLGHLSNEDGAGAMIRSLGYNTKKIYLGHLSKENNIKELAHMTMVN
QLAMADLAVGTDFTVHDTSPDTACPLTDI
MNESGFKYSILASGSTGNCFYLETPKKRLLIDAGLTGKKITSLLAEIDRKPEDLDAILITHEHSDHIKGVGVMARKYHLD
VYANEKTWQLMDECNMLGKLDASQKHIFQRDKVLTFGDVDIESFGVSHDAIDPQFYRIMKDNKSFVMLTDTGYVSDRMTG
IIENADGYLIESNHDIEILRSGSYPWSLKQRILSDLGHLSNEDGAGAMIRSLGYNTKKIYLGHLSKENNIKELAHMTMVN
QLAMADLAVGTDFTVHDTSPDTACPLTDI
Nucleotide
Download Length: 810 bp
>NTDB_id=371881 FNL90_RS02405 WP_023612763.1 453860..454669(+) (vicX) [Streptococcus pyogenes strain 37-97S]
ATGAATGAGAGTGGTTTTAAATACAGTATTTTAGCATCTGGGTCCACAGGAAATTGTTTTTATTTAGAAACACCTAAAAA
ACGCTTATTGATTGATGCAGGGCTTACTGGTAAGAAAATTACCAGTCTTCTTGCTGAAATTGACCGCAAACCTGAGGATT
TGGATGCTATTTTGATTACCCATGAGCACTCTGACCATATTAAGGGTGTAGGCGTTATGGCCCGCAAATACCATTTGGAT
GTCTATGCTAATGAAAAAACATGGCAGCTGATGGATGAGTGCAATATGCTAGGTAAGCTTGATGCCTCACAAAAACATAT
TTTCCAAAGGGATAAAGTTTTGACCTTTGGAGATGTTGATATCGAAAGTTTTGGAGTCAGCCATGACGCTATTGATCCTC
AATTTTATCGGATTATGAAAGATAATAAGTCTTTTGTGATGTTGACAGATACAGGATATGTCAGTGATAGGATGACAGGT
ATTATTGAAAATGCAGATGGCTACTTGATTGAATCCAATCATGATATTGAAATTTTGAGATCAGGCTCTTATCCTTGGAG
CTTGAAGCAGCGTATTTTATCTGATTTAGGACATTTATCAAATGAAGATGGAGCGGGAGCCATGATTAGAAGCCTGGGGT
ACAATACCAAAAAAATATACCTAGGTCATCTGAGTAAAGAAAATAACATCAAAGAGTTAGCGCATATGACGATGGTCAAT
CAACTGGCTATGGCAGATTTAGCAGTAGGTACAGACTTTACGGTTCATGATACCTCTCCAGATACTGCTTGTCCATTAAC
TGATATTTGA
ATGAATGAGAGTGGTTTTAAATACAGTATTTTAGCATCTGGGTCCACAGGAAATTGTTTTTATTTAGAAACACCTAAAAA
ACGCTTATTGATTGATGCAGGGCTTACTGGTAAGAAAATTACCAGTCTTCTTGCTGAAATTGACCGCAAACCTGAGGATT
TGGATGCTATTTTGATTACCCATGAGCACTCTGACCATATTAAGGGTGTAGGCGTTATGGCCCGCAAATACCATTTGGAT
GTCTATGCTAATGAAAAAACATGGCAGCTGATGGATGAGTGCAATATGCTAGGTAAGCTTGATGCCTCACAAAAACATAT
TTTCCAAAGGGATAAAGTTTTGACCTTTGGAGATGTTGATATCGAAAGTTTTGGAGTCAGCCATGACGCTATTGATCCTC
AATTTTATCGGATTATGAAAGATAATAAGTCTTTTGTGATGTTGACAGATACAGGATATGTCAGTGATAGGATGACAGGT
ATTATTGAAAATGCAGATGGCTACTTGATTGAATCCAATCATGATATTGAAATTTTGAGATCAGGCTCTTATCCTTGGAG
CTTGAAGCAGCGTATTTTATCTGATTTAGGACATTTATCAAATGAAGATGGAGCGGGAGCCATGATTAGAAGCCTGGGGT
ACAATACCAAAAAAATATACCTAGGTCATCTGAGTAAAGAAAATAACATCAAAGAGTTAGCGCATATGACGATGGTCAAT
CAACTGGCTATGGCAGATTTAGCAGTAGGTACAGACTTTACGGTTCATGATACCTCTCCAGATACTGCTTGTCCATTAAC
TGATATTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| vicX | Streptococcus mutans UA159 |
76.208 |
100 |
0.762 |