Detailed information    

insolico Bioinformatically predicted

Overview


Name   vicK   Type   Regulator
Locus tag   FNL90_RS02400 Genome accession   NZ_CP041408
Coordinates   452504..453856 (+) Length   450 a.a.
NCBI ID   WP_014407395.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain 37-97S     
Function   repress comCDE expression; repress comX expression (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 404334..476749 452504..453856 within 0


Gene organization within MGE regions


Location: 404334..476749
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FNL90_RS09975 (FNL90_02210) - 404543..404854 (+) 312 WP_227874480.1 CPBP family intramembrane glutamic endopeptidase -
  FNL90_RS09710 - 404939..405067 (+) 129 WP_002994583.1 hypothetical protein -
  FNL90_RS02140 (FNL90_02215) - 405465..405692 (+) 228 WP_028797129.1 Blp family class II bacteriocin -
  FNL90_RS02145 (FNL90_02220) - 405741..406058 (+) 318 WP_002994587.1 hypothetical protein -
  FNL90_RS09715 - 406178..407262 (+) 1085 Protein_376 IS3 family transposase -
  FNL90_RS02165 (FNL90_02240) - 407466..408864 (+) 1399 Protein_377 IS1182 family transposase -
  FNL90_RS02170 (FNL90_02245) comE/blpR 409112..409861 (+) 750 WP_002992578.1 response regulator transcription factor Regulator
  FNL90_RS02175 (FNL90_02250) - 409862..411196 (+) 1335 WP_047235191.1 sensor histidine kinase -
  FNL90_RS09890 (FNL90_02255) - 411344..411463 (-) 120 WP_185168158.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  FNL90_RS02185 (FNL90_02260) - 411547..412911 (-) 1365 WP_014635340.1 bacteriocin secretion accessory protein -
  FNL90_RS02190 (FNL90_02265) comA/nlmT 412922..415075 (-) 2154 WP_047235192.1 peptide cleavage/export ABC transporter Regulator
  FNL90_RS02195 (FNL90_02275) - 415528..416214 (+) 687 Protein_383 transposase -
  FNL90_RS02200 (FNL90_02280) - 416402..416659 (+) 258 WP_023078219.1 Blp family class II bacteriocin -
  FNL90_RS02205 (FNL90_02285) - 416674..416856 (+) 183 WP_002987564.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  FNL90_RS02210 (FNL90_02290) - 417047..417733 (-) 687 Protein_386 transposase -
  FNL90_RS02215 (FNL90_02295) - 418053..418280 (+) 228 WP_002992018.1 Blp family class II bacteriocin -
  FNL90_RS02220 (FNL90_02300) - 418293..418493 (+) 201 WP_002985729.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  FNL90_RS09720 (FNL90_02310) - 418855..418983 (+) 129 WP_002985724.1 hypothetical protein -
  FNL90_RS02225 (FNL90_02320) - 419509..419910 (+) 402 WP_047235194.1 hypothetical protein -
  FNL90_RS02230 (FNL90_02325) - 420161..421231 (+) 1071 WP_047235195.1 hypothetical protein -
  FNL90_RS02235 (FNL90_02330) - 421324..421722 (+) 399 WP_038433666.1 hypothetical protein -
  FNL90_RS02240 (FNL90_02335) stcA 422070..422339 (-) 270 WP_011017467.1 quorum-sensing system protein StcA -
  FNL90_RS02245 - 422734..422913 (-) 180 WP_011184266.1 hypothetical protein -
  FNL90_RS09895 (FNL90_02340) - 422862..423104 (-) 243 WP_002985713.1 hypothetical protein -
  FNL90_RS02250 (FNL90_02345) shp2 423254..423322 (-) 69 WP_128650799.1 peptide pheromone SHP2 -
  FNL90_RS02255 (FNL90_02350) rgg2 423411..424277 (+) 867 WP_002990747.1 quorum-sensing system transcriptional regulator Rgg2 -
  FNL90_RS02260 (FNL90_02355) mutM 424449..425276 (+) 828 WP_002990742.1 DNA-formamidopyrimidine glycosylase -
  FNL90_RS02265 (FNL90_02360) coaE 425273..425866 (+) 594 WP_047235583.1 dephospho-CoA kinase -
  FNL90_RS02270 (FNL90_02365) - 426066..427568 (+) 1503 WP_047235196.1 helicase HerA-like domain-containing protein -
  FNL90_RS02275 (FNL90_02370) - 427690..428883 (+) 1194 WP_002994146.1 multidrug efflux MFS transporter -
  FNL90_RS02280 (FNL90_02375) rpmG 428880..429026 (+) 147 WP_002990729.1 50S ribosomal protein L33 -
  FNL90_RS02285 (FNL90_02380) secG 429072..429308 (+) 237 WP_047235197.1 preprotein translocase subunit SecG -
  FNL90_RS02290 (FNL90_02385) rnr 429402..431735 (+) 2334 WP_080342657.1 ribonuclease R -
  FNL90_RS02295 (FNL90_02390) smpB 431738..432205 (+) 468 WP_047235198.1 SsrA-binding protein SmpB -
  FNL90_RS02300 (FNL90_02395) - 432211..432930 (+) 720 WP_010921981.1 glutaminyl-peptide cyclotransferase -
  FNL90_RS02305 (FNL90_02400) pcp 433048..433695 (-) 648 WP_047235199.1 pyroglutamyl-peptidase I -
  FNL90_RS02310 (FNL90_02405) - 433745..434671 (-) 927 WP_011184272.1 DUF979 domain-containing protein -
  FNL90_RS02315 (FNL90_02410) - 434671..435354 (-) 684 WP_014635345.1 DUF969 domain-containing protein -
  FNL90_RS02320 (FNL90_02415) - 435565..436491 (-) 927 WP_002994177.1 glycosyltransferase family 2 protein -
  FNL90_RS02325 (FNL90_02420) - 436636..437013 (-) 378 WP_002985686.1 VOC family protein -
  FNL90_RS02330 (FNL90_02425) - 437024..437689 (-) 666 WP_002985684.1 NAD(P)H-dependent oxidoreductase -
  FNL90_RS02335 (FNL90_02430) - 437738..438823 (-) 1086 WP_011054264.1 aminopeptidase P family protein -
  FNL90_RS02340 (FNL90_02435) ccpA 438997..439998 (+) 1002 WP_002985680.1 catabolite control protein A Regulator
  FNL90_RS02345 (FNL90_02440) - 440129..441127 (+) 999 WP_002985678.1 glycosyltransferase family 4 protein -
  FNL90_RS02350 (FNL90_02445) - 441129..442463 (+) 1335 WP_002985676.1 glycosyltransferase family 4 protein -
  FNL90_RS02355 (FNL90_02450) thrS 442885..444828 (+) 1944 WP_047235200.1 threonine--tRNA ligase -
  FNL90_RS02360 (FNL90_02455) - 444969..445961 (+) 993 WP_011017482.1 ATP-binding cassette domain-containing protein -
  FNL90_RS02365 (FNL90_02460) - 445963..446781 (+) 819 WP_047235201.1 ABC-2 family transporter protein -
  FNL90_RS02370 (FNL90_02465) - 446783..447568 (+) 786 WP_002985667.1 ABC transporter permease -
  FNL90_RS02375 (FNL90_02470) - 447653..447802 (+) 150 WP_011285429.1 hypothetical protein -
  FNL90_RS02380 (FNL90_02475) - 448197..449345 (+) 1149 WP_047235202.1 acetyl-CoA C-acyltransferase -
  FNL90_RS02385 (FNL90_02480) - 449302..450549 (+) 1248 WP_047235203.1 AMP-binding protein -
  FNL90_RS02390 (FNL90_02485) - 450605..451639 (+) 1035 WP_174147118.1 DUF3114 domain-containing protein -
  FNL90_RS02395 (FNL90_02490) vicR 451801..452511 (+) 711 WP_002985645.1 response regulator YycF Regulator
  FNL90_RS02400 (FNL90_02495) vicK 452504..453856 (+) 1353 WP_014407395.1 cell wall metabolism sensor histidine kinase VicK Regulator
  FNL90_RS02405 (FNL90_02500) vicX 453860..454669 (+) 810 WP_023612763.1 MBL fold metallo-hydrolase Regulator
  FNL90_RS02410 (FNL90_02505) rnc 455088..455780 (+) 693 WP_002990670.1 ribonuclease III -
  FNL90_RS02415 (FNL90_02510) smc 455781..459320 (+) 3540 WP_047235204.1 chromosome segregation protein SMC -
  FNL90_RS02420 (FNL90_02515) rgg3 459573..460424 (-) 852 WP_002985634.1 quorum-sensing system transcriptional regulator Rgg3 -
  FNL90_RS02425 (FNL90_02520) shp3 460504..460575 (+) 72 WP_128650800.1 peptide pheromone SHP3 -
  FNL90_RS02430 (FNL90_02525) - 460644..461570 (+) 927 WP_020833336.1 shikimate dehydrogenase -
  FNL90_RS02435 (FNL90_02530) - 461567..462403 (+) 837 WP_002985631.1 sugar phosphate isomerase/epimerase -
  FNL90_RS02440 (FNL90_02535) cofE 462405..463139 (+) 735 WP_002994761.1 coenzyme F420-0:L-glutamate ligase -
  FNL90_RS02445 (FNL90_02540) - 463132..464118 (+) 987 WP_009880286.1 dehydrogenase -
  FNL90_RS02450 (FNL90_02545) - 464128..465327 (+) 1200 WP_002985626.1 methionine adenosyltransferase -
  FNL90_RS02455 (FNL90_02550) - 465311..466279 (+) 969 WP_002985624.1 serine kinase -
  FNL90_RS02460 (FNL90_02555) - 466334..467323 (+) 990 WP_009880288.1 glycosyltransferase -
  FNL90_RS02465 (FNL90_02565) - 468015..469172 (+) 1158 WP_009880289.1 nucleotide sugar dehydrogenase -
  FNL90_RS02470 (FNL90_02570) - 469257..470465 (+) 1209 WP_032464248.1 MFS transporter -
  FNL90_RS02475 (FNL90_02575) - 470568..470777 (-) 210 WP_002985621.1 helix-turn-helix transcriptional regulator -
  FNL90_RS02485 (FNL90_02585) - 470758..472425 (-) 1668 Protein_442 DUF2326 domain-containing protein -
  FNL90_RS02490 (FNL90_02590) - 472416..472640 (-) 225 WP_001176803.1 ABC-three component system middle component 7 -
  FNL90_RS02495 (FNL90_02595) - 472640..473533 (-) 894 WP_080342658.1 ABC-three component system protein -
  FNL90_RS02500 (FNL90_02600) - 473468..473725 (+) 258 WP_229699512.1 terminase TerL endonuclease subunit -
  FNL90_RS02505 (FNL90_02605) - 473780..474082 (+) 303 WP_002991611.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
  FNL90_RS02510 (FNL90_02610) - 474082..474387 (+) 306 Protein_447 type II toxin-antitoxin system RelE/ParE family toxin -
  FNL90_RS02515 (FNL90_02615) - 474406..474678 (+) 273 WP_002985604.1 hypothetical protein -
  FNL90_RS09725 - 474783..474917 (+) 135 Protein_449 portal protein -

Sequence


Protein


Download         Length: 450 a.a.        Molecular weight: 51377.79 Da        Isoelectric Point: 5.4026

>NTDB_id=371880 FNL90_RS02400 WP_014407395.1 452504..453856(+) (vicK) [Streptococcus pyogenes strain 37-97S]
MTRDIIGNLSTFELAILILLVFVAFYFIHLAVRDYRNARIIRMMSHKIRDLINGRYTDIIDEKADVELMELSDQLNDLSD
VFRLTHENLAQEKNRLASILAYMSDGVLATDRSGKIIMINETARKQLNLSKEEALKKNITDLLEGDTSYTYRDLVSKTPV
VTVNSRNDMGEFVSLRLRFALNRRESGFISGLVVVLHDTTEQEKEERERRLFVSNVSHELRTPLTSVKSYLEALDEGALK
EDIAPSFIKVSLDETNRMMRMISDLLNLSRIDNQVTQLAVEMTNFTAFITSILNRFDLVKNQHTGTGKVYEIVRDYPITS
VWIEIDNDKMTQVIENILNNAIKYSPDGGKITVRMKTTDTQLIISISDQGLGIPKTDLPLIFDRFYRVDKARSRAQGGTG
LGLAIAKEIIKQHHGFIWAKSDYGKGSTFTIVLPYEKDAAIYEEWEEDVD

Nucleotide


Download         Length: 1353 bp        

>NTDB_id=371880 FNL90_RS02400 WP_014407395.1 452504..453856(+) (vicK) [Streptococcus pyogenes strain 37-97S]
ATGACTAGAGATATCATTGGAAACTTATCCACATTTGAATTAGCGATCCTTATCTTACTTGTTTTTGTTGCTTTTTACTT
TATCCATCTTGCGGTGCGTGATTACCGAAATGCACGTATTATTCGGATGATGAGCCATAAAATCCGAGACTTGATTAATG
GTCGCTATACTGATATAATCGACGAAAAAGCAGACGTTGAGTTAATGGAGCTTTCAGACCAGTTAAATGACCTGTCAGAT
GTTTTTCGCTTGACGCATGAAAATCTTGCCCAAGAAAAAAATCGCTTGGCAAGTATTTTGGCTTATATGTCAGATGGTGT
ACTTGCTACAGACCGGTCTGGTAAAATCATCATGATTAACGAGACAGCTCGCAAGCAATTAAATTTAAGTAAAGAAGAGG
CACTAAAGAAAAACATTACAGATTTGTTAGAAGGTGATACTTCATATACCTACCGTGATTTGGTATCCAAAACACCAGTG
GTAACTGTTAATAGCCGAAATGATATGGGTGAGTTTGTCTCATTACGCTTGCGTTTTGCGTTGAATAGGAGAGAGAGTGG
TTTTATTTCGGGCTTGGTTGTGGTGCTCCATGACACCACAGAACAAGAAAAAGAAGAACGTGAACGCCGTCTTTTTGTTT
CTAATGTAAGTCATGAATTAAGGACCCCTTTAACTTCGGTTAAATCCTACTTGGAGGCTCTTGATGAAGGTGCACTTAAA
GAAGATATTGCTCCAAGTTTCATAAAAGTTTCTCTTGATGAAACTAATCGGATGATGCGTATGATTTCAGATCTTTTAAA
CCTGTCTCGGATTGATAATCAAGTAACCCAATTAGCAGTAGAGATGACTAATTTTACTGCTTTTATAACTTCTATTTTAA
ACAGATTTGATTTGGTTAAAAATCAGCATACAGGTACAGGAAAAGTCTATGAAATTGTAAGAGATTACCCTATTACCTCT
GTCTGGATTGAAATTGATAATGATAAAATGACACAGGTTATCGAGAATATTTTGAACAATGCCATTAAGTATTCTCCAGA
TGGTGGAAAAATTACAGTCCGTATGAAAACAACAGATACCCAATTAATTATTTCCATTTCAGACCAAGGACTAGGTATCC
CTAAAACAGATTTGCCTCTTATTTTTGATCGGTTCTATCGTGTAGACAAGGCAAGAAGTCGTGCCCAAGGAGGGACCGGT
CTAGGCCTTGCCATTGCTAAAGAAATCATCAAGCAGCACCATGGCTTTATCTGGGCTAAGAGTGACTATGGTAAAGGATC
GACCTTTACTATTGTCTTGCCTTATGAAAAAGATGCAGCCATCTATGAAGAATGGGAGGAAGATGTAGACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  vicK Streptococcus mutans UA159

72.947

92

0.671

  micB Streptococcus pneumoniae Cp1015

67.765

94.444

0.64


Multiple sequence alignment