Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CXB71_RS12795 | Genome accession | NZ_CP041361 |
| Coordinates | 2613344..2613517 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain WRN014 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2608344..2618517
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CXB71_RS12780 (CXB71_12780) | gcvT | 2609162..2610262 (-) | 1101 | WP_058906182.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CXB71_RS12785 (CXB71_12785) | - | 2610685..2612355 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| CXB71_RS12790 (CXB71_12790) | - | 2612373..2613167 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| CXB71_RS12795 (CXB71_12795) | sinI | 2613344..2613517 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| CXB71_RS12800 (CXB71_12800) | sinR | 2613551..2613886 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CXB71_RS12805 (CXB71_12805) | tasA | 2613934..2614719 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| CXB71_RS12810 (CXB71_12810) | sipW | 2614783..2615367 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| CXB71_RS12815 (CXB71_12815) | tapA | 2615339..2616010 (-) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CXB71_RS12820 (CXB71_12820) | - | 2616269..2616598 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| CXB71_RS12825 (CXB71_12825) | - | 2616638..2616817 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| CXB71_RS12830 (CXB71_12830) | comGG | 2616874..2617251 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CXB71_RS12835 (CXB71_12835) | comGF | 2617252..2617752 (-) | 501 | WP_223203779.1 | competence type IV pilus minor pilin ComGF | - |
| CXB71_RS12840 (CXB71_12840) | comGE | 2617661..2617975 (-) | 315 | WP_003153089.1 | competence type IV pilus minor pilin ComGE | - |
| CXB71_RS12845 (CXB71_12845) | comGD | 2617959..2618396 (-) | 438 | WP_003153088.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=371584 CXB71_RS12795 WP_003153105.1 2613344..2613517(+) (sinI) [Bacillus velezensis strain WRN014]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=371584 CXB71_RS12795 WP_003153105.1 2613344..2613517(+) (sinI) [Bacillus velezensis strain WRN014]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |