Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BvL003_RS15000 Genome accession   NZ_CP041192
Coordinates   3047487..3047627 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain BvL03     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3042487..3052627
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BvL003_RS14975 (BvL003_15155) - 3042814..3043197 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  BvL003_RS14980 (BvL003_15160) comA 3043219..3043863 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  BvL003_RS14985 (BvL003_15165) comP 3043944..3046250 (-) 2307 WP_153986739.1 sensor histidine kinase Regulator
  BvL003_RS14990 (BvL003_15170) comX 3046269..3046445 (-) 177 WP_044052947.1 competence pheromone ComX -
  BvL003_RS14995 (BvL003_15175) - 3046460..3047335 (-) 876 WP_146277410.1 polyprenyl synthetase family protein -
  BvL003_RS15000 (BvL003_15180) degQ 3047487..3047627 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BvL003_RS15005 (BvL003_15190) - 3048092..3048433 (+) 342 WP_014305721.1 hypothetical protein -
  BvL003_RS15010 (BvL003_15195) - 3048440..3049660 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  BvL003_RS15015 (BvL003_15200) - 3049790..3051256 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  BvL003_RS15020 (BvL003_15205) - 3051274..3051825 (-) 552 WP_146275407.1 cysteine hydrolase family protein -
  BvL003_RS15025 (BvL003_15210) - 3051922..3052320 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=370391 BvL003_RS15000 WP_003152043.1 3047487..3047627(-) (degQ) [Bacillus velezensis strain BvL03]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=370391 BvL003_RS15000 WP_003152043.1 3047487..3047627(-) (degQ) [Bacillus velezensis strain BvL03]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment