Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BvL003_RS11550 | Genome accession | NZ_CP041192 |
| Coordinates | 2420152..2420325 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain BvL03 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2415152..2425325
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BvL003_RS11535 (BvL003_11690) | gcvT | 2415969..2417069 (-) | 1101 | WP_094247736.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BvL003_RS11540 (BvL003_11695) | - | 2417493..2419163 (+) | 1671 | WP_128574830.1 | DEAD/DEAH box helicase | - |
| BvL003_RS11545 (BvL003_11700) | - | 2419181..2419975 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| BvL003_RS11550 (BvL003_11705) | sinI | 2420152..2420325 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| BvL003_RS11555 (BvL003_11710) | sinR | 2420359..2420694 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BvL003_RS11560 (BvL003_11715) | tasA | 2420742..2421527 (-) | 786 | WP_094247735.1 | biofilm matrix protein TasA | - |
| BvL003_RS11565 (BvL003_11720) | sipW | 2421591..2422175 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| BvL003_RS11570 (BvL003_11725) | tapA | 2422147..2422818 (-) | 672 | WP_070082109.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BvL003_RS11575 (BvL003_11730) | - | 2423077..2423406 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| BvL003_RS11580 (BvL003_11735) | - | 2423446..2423625 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BvL003_RS11585 (BvL003_11740) | comGG | 2423682..2424059 (-) | 378 | WP_094247734.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BvL003_RS11590 (BvL003_11745) | comGF | 2424060..2424560 (-) | 501 | WP_227005764.1 | competence type IV pilus minor pilin ComGF | - |
| BvL003_RS11595 (BvL003_11750) | comGE | 2424469..2424783 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BvL003_RS11600 (BvL003_11755) | comGD | 2424767..2425204 (-) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=370369 BvL003_RS11550 WP_003153105.1 2420152..2420325(+) (sinI) [Bacillus velezensis strain BvL03]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=370369 BvL003_RS11550 WP_003153105.1 2420152..2420325(+) (sinI) [Bacillus velezensis strain BvL03]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |