Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   D073_RS14740 Genome accession   NZ_CP041145
Coordinates   2991429..2991569 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain At1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2986429..2996569
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D073_RS14715 (D073_2782) - 2986743..2987126 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  D073_RS14720 (D073_2783) comA 2987148..2987792 (-) 645 WP_140983798.1 response regulator transcription factor Regulator
  D073_RS14725 (D073_2784) comP 2987873..2990224 (-) 2352 WP_020956269.1 sensor histidine kinase Regulator
  D073_RS14730 comX 2990202..2990372 (-) 171 WP_015418105.1 competence pheromone ComX -
  D073_RS14735 (D073_2785) - 2990369..2991298 (-) 930 WP_231945405.1 polyprenyl synthetase family protein -
  D073_RS14740 (D073_2786) degQ 2991429..2991569 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  D073_RS14750 (D073_2787) - 2992035..2992376 (+) 342 WP_007408677.1 hypothetical protein -
  D073_RS14755 (D073_2788) - 2992383..2993606 (-) 1224 WP_020956271.1 EAL and HDOD domain-containing protein -
  D073_RS14760 (D073_2789) - 2993736..2995202 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  D073_RS14765 (D073_2790) - 2995220..2995771 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  D073_RS14770 (D073_2791) - 2995868..2996266 (-) 399 WP_020956272.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=369846 D073_RS14740 WP_003152043.1 2991429..2991569(-) (degQ) [Bacillus velezensis strain At1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=369846 D073_RS14740 WP_003152043.1 2991429..2991569(-) (degQ) [Bacillus velezensis strain At1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment