Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D073_RS11620 | Genome accession | NZ_CP041145 |
| Coordinates | 2409434..2409607 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain At1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2404434..2414607
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D073_RS11605 (D073_2200) | gcvT | 2405247..2406347 (-) | 1101 | WP_020956076.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D073_RS11610 (D073_2201) | - | 2406771..2408441 (+) | 1671 | WP_007408331.1 | DEAD/DEAH box helicase | - |
| D073_RS11615 (D073_2202) | - | 2408463..2409257 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| D073_RS11620 (D073_2203) | sinI | 2409434..2409607 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| D073_RS11625 (D073_2204) | sinR | 2409641..2409976 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| D073_RS11630 (D073_2205) | tasA | 2410024..2410809 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| D073_RS11635 (D073_2206) | sipW | 2410874..2411458 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| D073_RS11640 (D073_2207) | tapA | 2411430..2412101 (-) | 672 | WP_020956077.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D073_RS11645 (D073_2208) | - | 2412360..2412689 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| D073_RS11650 (D073_2209) | - | 2412729..2412908 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| D073_RS11655 (D073_2210) | comGG | 2412965..2413342 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| D073_RS11660 (D073_2211) | comGF | 2413343..2413843 (-) | 501 | WP_260485564.1 | competence type IV pilus minor pilin ComGF | - |
| D073_RS11665 (D073_2212) | comGE | 2413752..2414066 (-) | 315 | WP_041482453.1 | competence type IV pilus minor pilin ComGE | - |
| D073_RS11670 (D073_2213) | comGD | 2414050..2414487 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=369825 D073_RS11620 WP_003153105.1 2409434..2409607(+) (sinI) [Bacillus velezensis strain At1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=369825 D073_RS11620 WP_003153105.1 2409434..2409607(+) (sinI) [Bacillus velezensis strain At1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |