Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   G3M67_RS00925 Genome accession   NZ_CP048601
Coordinates   197971..198084 (-) Length   37 a.a.
NCBI ID   WP_001217875.1    Uniprot ID   -
Organism   Helicobacter pylori strain GCT 27     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 192971..203084
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G3M67_RS00905 (G3M67_00905) - 193583..194995 (-) 1413 WP_163524293.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  G3M67_RS00910 (G3M67_00910) comB10 195065..196201 (-) 1137 WP_021173411.1 DNA type IV secretion system protein ComB10 Machinery gene
  G3M67_RS00915 (G3M67_00915) comB9 196194..197231 (-) 1038 WP_163524294.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  G3M67_RS00920 (G3M67_00920) comB8 197231..197974 (-) 744 WP_128039635.1 virB8 family protein Machinery gene
  G3M67_RS00925 (G3M67_00925) comB7 197971..198084 (-) 114 WP_001217875.1 hypothetical protein Machinery gene
  G3M67_RS00930 (G3M67_00930) comB6 198100..199155 (-) 1056 WP_163525587.1 P-type conjugative transfer protein TrbL Machinery gene
  G3M67_RS00935 (G3M67_00935) - 199163..200167 (-) 1005 WP_163525588.1 PDZ domain-containing protein -
  G3M67_RS00940 (G3M67_00940) - 200167..200469 (-) 303 WP_000347931.1 YbaB/EbfC family nucleoid-associated protein -
  G3M67_RS00945 (G3M67_00945) panD 200472..200825 (-) 354 WP_097705594.1 aspartate 1-decarboxylase -
  G3M67_RS00950 (G3M67_00950) - 200815..203043 (-) 2229 WP_001978629.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4265.20 Da        Isoelectric Point: 9.5670

>NTDB_id=369723 G3M67_RS00925 WP_001217875.1 197971..198084(-) (comB7) [Helicobacter pylori strain GCT 27]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=369723 G3M67_RS00925 WP_001217875.1 197971..198084(-) (comB7) [Helicobacter pylori strain GCT 27]
ATGAGGATTTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAGAAAAGCCCTTG
CACCTTGCATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

94.595

100

0.946


Multiple sequence alignment