Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   FIM06_RS02005 Genome accession   NZ_CP041144
Coordinates   394827..394946 (+) Length   39 a.a.
NCBI ID   WP_033575081.1    Uniprot ID   -
Organism   Bacillus velezensis strain UCMB5044     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 389827..399946
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FIM06_RS01990 (FIM06_0388) - 391439..392122 (+) 684 WP_007609386.1 response regulator transcription factor -
  FIM06_RS01995 (FIM06_0389) - 392109..393536 (+) 1428 WP_181364943.1 HAMP domain-containing sensor histidine kinase -
  FIM06_RS02000 (FIM06_0390) rapC 393695..394843 (+) 1149 WP_029326229.1 Rap family tetratricopeptide repeat protein Regulator
  FIM06_RS02005 (FIM06_0391) phrC 394827..394946 (+) 120 WP_033575081.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  FIM06_RS02010 - 395095..395205 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  FIM06_RS02015 (FIM06_0392) - 395285..396649 (-) 1365 WP_105938096.1 aspartate kinase -
  FIM06_RS02020 (FIM06_0393) ceuB 397063..398016 (+) 954 WP_032872883.1 ABC transporter permease Machinery gene
  FIM06_RS02025 (FIM06_0394) - 398006..398953 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  FIM06_RS02030 (FIM06_0395) - 398947..399705 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=369720 FIM06_RS02005 WP_033575081.1 394827..394946(+) (phrC) [Bacillus velezensis strain UCMB5044]
MKLKSKWFVICLAAAAIFTVTGAGQTDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=369720 FIM06_RS02005 WP_033575081.1 394827..394946(+) (phrC) [Bacillus velezensis strain UCMB5044]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744


Multiple sequence alignment