Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   FED49_RS14885 Genome accession   NZ_CP040747
Coordinates   2833023..2833163 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain HQ-51-Ba     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2828023..2838163
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FED49_RS14860 - 2828358..2828747 (-) 390 WP_099496715.1 hotdog fold thioesterase -
  FED49_RS14865 comA 2828771..2829412 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  FED49_RS14870 comP 2829493..2831784 (-) 2292 WP_138826357.1 ATP-binding protein Regulator
  FED49_RS14875 comX 2831791..2831979 (-) 189 WP_306160900.1 competence pheromone ComX -
  FED49_RS14880 - 2831948..2832871 (-) 924 WP_138826360.1 polyprenyl synthetase family protein -
  FED49_RS14885 degQ 2833023..2833163 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  FED49_RS14890 - 2833669..2834022 (+) 354 WP_019744042.1 hypothetical protein -
  FED49_RS14895 - 2834065..2835291 (-) 1227 WP_035389266.1 EAL and HDOD domain-containing protein -
  FED49_RS14900 - 2835432..2836901 (-) 1470 WP_017358937.1 nicotinate phosphoribosyltransferase -
  FED49_RS14905 - 2836919..2837470 (-) 552 WP_008345872.1 cysteine hydrolase family protein -
  FED49_RS14910 - 2837531..2837938 (-) 408 WP_041091828.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=366964 FED49_RS14885 WP_003213123.1 2833023..2833163(-) (degQ) [Bacillus altitudinis strain HQ-51-Ba]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=366964 FED49_RS14885 WP_003213123.1 2833023..2833163(-) (degQ) [Bacillus altitudinis strain HQ-51-Ba]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment