Detailed information
Bioinformatically predicted
Overview
| Name | CJE1441 | Type | Regulator |
| Locus tag | FBF02_RS08375 | Genome accession | NZ_CP040608 |
| Coordinates | 1627639..1628292 (-) | Length | 217 a.a. |
| NCBI ID | WP_011049930.1 | Uniprot ID | A0A3X8NAQ4 |
| Organism | Campylobacter sp. CFSAN093226 | ||
| Function | repress natural transformation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1596599..1638848 | 1627639..1628292 | within | 0 |
Gene organization within MGE regions
Location: 1596599..1638848
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FBF02_RS08185 (FBF02_08240) | recA | 1596599..1597630 (-) | 1032 | WP_002851424.1 | recombinase RecA | Machinery gene |
| FBF02_RS08190 (FBF02_08245) | - | 1597736..1598596 (+) | 861 | WP_002857964.1 | menaquinone biosynthesis family protein | - |
| FBF02_RS08195 (FBF02_08250) | fliQ | 1598608..1598877 (+) | 270 | WP_002851290.1 | flagellar biosynthesis protein FliQ | - |
| FBF02_RS08200 (FBF02_08255) | - | 1598874..1599650 (+) | 777 | WP_002858257.1 | UDP-N-acetylmuramate dehydrogenase | - |
| FBF02_RS08210 (FBF02_08265) | - | 1599842..1602399 (+) | 2558 | Protein_1601 | hypothetical protein | - |
| FBF02_RS08215 (FBF02_08270) | - | 1602814..1603104 (+) | 291 | WP_002788257.1 | hypothetical protein | - |
| FBF02_RS08220 (FBF02_08275) | - | 1603091..1603441 (+) | 351 | WP_002869973.1 | HNH endonuclease signature motif containing protein | - |
| FBF02_RS08225 (FBF02_08280) | - | 1603692..1604330 (+) | 639 | WP_002913306.1 | P27 family phage terminase small subunit | - |
| FBF02_RS08230 (FBF02_08285) | - | 1604334..1605959 (+) | 1626 | WP_002913304.1 | terminase TerL endonuclease subunit | - |
| FBF02_RS08235 (FBF02_08290) | - | 1606014..1606448 (+) | 435 | WP_002913302.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| FBF02_RS08240 (FBF02_08295) | - | 1606608..1607780 (+) | 1173 | WP_002788272.1 | phage portal protein | - |
| FBF02_RS08245 (FBF02_08300) | - | 1607777..1608319 (+) | 543 | WP_002800770.1 | HK97 gp10 family phage protein | - |
| FBF02_RS08250 (FBF02_08305) | - | 1608320..1608670 (+) | 351 | WP_002788276.1 | hypothetical protein | - |
| FBF02_RS08255 (FBF02_08310) | - | 1608658..1608921 (-) | 264 | WP_002869971.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| FBF02_RS08260 (FBF02_08315) | - | 1608918..1609142 (-) | 225 | WP_002869970.1 | DUF6290 family protein | - |
| FBF02_RS08265 (FBF02_08320) | - | 1609289..1610269 (+) | 981 | WP_002788279.1 | hypothetical protein | - |
| FBF02_RS08270 (FBF02_08325) | - | 1610266..1610622 (+) | 357 | WP_002788281.1 | hypothetical protein | - |
| FBF02_RS08275 (FBF02_08330) | - | 1610703..1610918 (+) | 216 | WP_002788282.1 | hypothetical protein | - |
| FBF02_RS08280 (FBF02_08335) | - | 1610910..1611248 (-) | 339 | WP_002788283.1 | hypothetical protein | - |
| FBF02_RS08285 (FBF02_08340) | - | 1611308..1617007 (+) | 5700 | WP_168940582.1 | hypothetical protein | - |
| FBF02_RS08290 (FBF02_08345) | - | 1617020..1617889 (+) | 870 | WP_002788286.1 | hypothetical protein | - |
| FBF02_RS08295 (FBF02_08350) | - | 1617975..1618532 (+) | 558 | WP_002788287.1 | HK97 family phage prohead protease | - |
| FBF02_RS08300 (FBF02_08355) | - | 1618549..1619715 (+) | 1167 | WP_002788288.1 | phage major capsid protein | - |
| FBF02_RS08305 (FBF02_08360) | - | 1619726..1619977 (+) | 252 | WP_002788291.1 | hypothetical protein | - |
| FBF02_RS08310 (FBF02_08365) | - | 1619974..1620411 (+) | 438 | WP_002788293.1 | phage gp6-like head-tail connector protein | - |
| FBF02_RS08315 (FBF02_08370) | - | 1620424..1620741 (+) | 318 | WP_002788295.1 | head-tail adaptor protein | - |
| FBF02_RS08320 (FBF02_08375) | - | 1620738..1621370 (+) | 633 | WP_002869967.1 | hypothetical protein | - |
| FBF02_RS08325 (FBF02_08380) | - | 1621363..1622928 (+) | 1566 | WP_011049933.1 | hypothetical protein | - |
| FBF02_RS08330 (FBF02_08385) | - | 1622930..1623379 (+) | 450 | WP_002798141.1 | hypothetical protein | - |
| FBF02_RS08335 (FBF02_08390) | - | 1623392..1624027 (+) | 636 | WP_002789149.1 | DUF4376 domain-containing protein | - |
| FBF02_RS08340 (FBF02_08395) | - | 1624024..1624407 (+) | 384 | WP_002869963.1 | hypothetical protein | - |
| FBF02_RS08345 (FBF02_08400) | - | 1624400..1624774 (+) | 375 | WP_019108750.1 | DUF1353 domain-containing protein | - |
| FBF02_RS08350 (FBF02_08405) | - | 1624771..1626054 (+) | 1284 | WP_002788854.1 | hypothetical protein | - |
| FBF02_RS08355 (FBF02_08410) | - | 1626103..1626564 (+) | 462 | WP_002870260.1 | DUF5675 family protein | - |
| FBF02_RS08360 (FBF02_08415) | - | 1626793..1627212 (+) | 420 | WP_002870261.1 | hypothetical protein | - |
| FBF02_RS08365 (FBF02_08420) | - | 1627130..1627327 (+) | 198 | WP_002913413.1 | hypothetical protein | - |
| FBF02_RS08370 (FBF02_08425) | - | 1627341..1627622 (-) | 282 | WP_002870263.1 | PLDc N-terminal domain-containing protein | - |
| FBF02_RS08375 (FBF02_08430) | CJE1441 | 1627639..1628292 (-) | 654 | WP_011049930.1 | DNA/RNA non-specific endonuclease | Regulator |
| FBF02_RS08380 (FBF02_08435) | - | 1628298..1628960 (-) | 663 | WP_002870274.1 | S24/S26 family peptidase | - |
| FBF02_RS08385 (FBF02_08440) | - | 1629195..1629848 (-) | 654 | WP_002870336.1 | hypothetical protein | - |
| FBF02_RS08390 (FBF02_08445) | - | 1630053..1630256 (+) | 204 | WP_002870299.1 | hypothetical protein | - |
| FBF02_RS08395 (FBF02_08450) | - | 1630253..1630537 (+) | 285 | WP_002912332.1 | hypothetical protein | - |
| FBF02_RS08400 (FBF02_08455) | - | 1630968..1631699 (+) | 732 | WP_011049928.1 | phage regulatory protein/antirepressor Ant | - |
| FBF02_RS08405 (FBF02_08460) | - | 1631752..1632039 (+) | 288 | WP_002787279.1 | YopX family protein | - |
| FBF02_RS08410 (FBF02_08465) | - | 1632096..1632359 (+) | 264 | WP_002787281.1 | hypothetical protein | - |
| FBF02_RS08415 (FBF02_08470) | - | 1632325..1632555 (+) | 231 | WP_002787283.1 | hypothetical protein | - |
| FBF02_RS08420 (FBF02_08475) | - | 1632693..1633460 (+) | 768 | WP_002787287.1 | hypothetical protein | - |
| FBF02_RS08425 (FBF02_08480) | - | 1633474..1633710 (+) | 237 | WP_002787289.1 | hypothetical protein | - |
| FBF02_RS08430 (FBF02_08485) | - | 1634098..1634418 (+) | 321 | WP_002787293.1 | hypothetical protein | - |
| FBF02_RS08435 (FBF02_08490) | - | 1634497..1634811 (+) | 315 | WP_002787295.1 | hypothetical protein | - |
| FBF02_RS08440 (FBF02_08495) | - | 1634748..1635509 (+) | 762 | WP_002869676.1 | hypothetical protein | - |
| FBF02_RS08445 (FBF02_08500) | - | 1635518..1635742 (+) | 225 | WP_011049924.1 | hypothetical protein | - |
| FBF02_RS08450 (FBF02_08505) | - | 1635743..1636114 (+) | 372 | WP_002858334.1 | hypothetical protein | - |
| FBF02_RS08455 (FBF02_08510) | - | 1636098..1636364 (+) | 267 | WP_002787304.1 | hypothetical protein | - |
| FBF02_RS08460 (FBF02_08515) | - | 1636342..1637097 (+) | 756 | WP_002787306.1 | site-specific DNA-methyltransferase | - |
| FBF02_RS08465 (FBF02_08520) | - | 1637115..1637468 (+) | 354 | WP_002787307.1 | hypothetical protein | - |
| FBF02_RS08470 (FBF02_08525) | - | 1637470..1637676 (+) | 207 | WP_002787309.1 | helix-turn-helix domain-containing protein | - |
| FBF02_RS08475 (FBF02_08530) | - | 1637673..1638848 (-) | 1176 | WP_002787311.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 217 a.a. Molecular weight: 25531.02 Da Isoelectric Point: 9.8742
>NTDB_id=365605 FBF02_RS08375 WP_011049930.1 1627639..1628292(-) (CJE1441) [Campylobacter sp. CFSAN093226]
MKKLIILSLLSTLAFADYTQYKPSEDFAKYFTKQNCSQVLDKFYYINCYDYSLKGTKAVAYRLEADNLKGEQIKKRPRFE
DDTNIPKKYRTTWSDYKNSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRVWNKIEKRERQVALKLGSLEVL
NLVNYDNNPQRIKNNIAIPSSYTKILKGDNFKECYQVPNHDVENENLRIYKVKCDNF
MKKLIILSLLSTLAFADYTQYKPSEDFAKYFTKQNCSQVLDKFYYINCYDYSLKGTKAVAYRLEADNLKGEQIKKRPRFE
DDTNIPKKYRTTWSDYKNSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRVWNKIEKRERQVALKLGSLEVL
NLVNYDNNPQRIKNNIAIPSSYTKILKGDNFKECYQVPNHDVENENLRIYKVKCDNF
Nucleotide
Download Length: 654 bp
>NTDB_id=365605 FBF02_RS08375 WP_011049930.1 1627639..1628292(-) (CJE1441) [Campylobacter sp. CFSAN093226]
ATGAAAAAACTTATAATCTTATCTTTATTATCCACTCTAGCTTTTGCTGATTATACACAATACAAACCAAGCGAAGATTT
TGCCAAGTATTTTACTAAACAAAACTGCTCACAAGTTTTGGATAAATTTTATTATATTAATTGTTATGATTATTCTTTAA
AAGGCACTAAAGCCGTAGCTTATAGATTAGAAGCGGATAATTTAAAAGGCGAACAAATCAAAAAACGCCCACGCTTTGAA
GATGATACAAATATTCCTAAAAAATACCGCACCACATGGAGTGATTATAAAAACAGCGGTTACGACAGGGGACACACTCT
TTCTAATGCTTCAATGAGAAAAACAACTCAAGCTCAAAGAAGCACTTTTTTAATGAGCAACATTACTCCACAAAATCCAC
AAATCAATCAAAGAGTTTGGAATAAAATTGAAAAAAGAGAAAGACAAGTAGCTTTAAAGCTTGGAAGTTTAGAAGTTTTA
AATTTGGTTAATTATGACAATAATCCACAAAGAATAAAAAACAATATTGCTATTCCAAGCTCTTACACTAAGATTTTAAA
AGGTGATAATTTTAAAGAATGTTACCAAGTGCCTAATCACGATGTAGAAAATGAGAATTTAAGAATATATAAAGTAAAAT
GTGACAATTTTTAA
ATGAAAAAACTTATAATCTTATCTTTATTATCCACTCTAGCTTTTGCTGATTATACACAATACAAACCAAGCGAAGATTT
TGCCAAGTATTTTACTAAACAAAACTGCTCACAAGTTTTGGATAAATTTTATTATATTAATTGTTATGATTATTCTTTAA
AAGGCACTAAAGCCGTAGCTTATAGATTAGAAGCGGATAATTTAAAAGGCGAACAAATCAAAAAACGCCCACGCTTTGAA
GATGATACAAATATTCCTAAAAAATACCGCACCACATGGAGTGATTATAAAAACAGCGGTTACGACAGGGGACACACTCT
TTCTAATGCTTCAATGAGAAAAACAACTCAAGCTCAAAGAAGCACTTTTTTAATGAGCAACATTACTCCACAAAATCCAC
AAATCAATCAAAGAGTTTGGAATAAAATTGAAAAAAGAGAAAGACAAGTAGCTTTAAAGCTTGGAAGTTTAGAAGTTTTA
AATTTGGTTAATTATGACAATAATCCACAAAGAATAAAAAACAATATTGCTATTCCAAGCTCTTACACTAAGATTTTAAA
AGGTGATAATTTTAAAGAATGTTACCAAGTGCCTAATCACGATGTAGAAAATGAGAATTTAAGAATATATAAAGTAAAAT
GTGACAATTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| CJE1441 | Campylobacter jejuni RM1221 |
100 |
100 |
1 |
| CJE0566 | Campylobacter jejuni RM1221 |
91.163 |
99.078 |
0.903 |