Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   FCJ76_RS16315 Genome accession   NZ_CP039935
Coordinates   3113644..3113784 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain H19     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3108644..3118784
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FCJ76_RS16290 yuxO 3108920..3109300 (-) 381 WP_071579112.1 hotdog fold thioesterase -
  FCJ76_RS16295 comA 3109319..3109963 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  FCJ76_RS16300 comP 3110044..3112356 (-) 2313 WP_099085219.1 histidine kinase Regulator
  FCJ76_RS16305 comX 3112372..3112593 (-) 222 WP_134982027.1 competence pheromone ComX -
  FCJ76_RS16310 - 3112590..3113459 (-) 870 WP_095843911.1 polyprenyl synthetase family protein -
  FCJ76_RS16315 degQ 3113644..3113784 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  FCJ76_RS16320 - 3114006..3114131 (+) 126 WP_128473219.1 hypothetical protein -
  FCJ76_RS16325 - 3114247..3114615 (+) 369 WP_017695529.1 hypothetical protein -
  FCJ76_RS16330 pdeH 3114591..3115820 (-) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  FCJ76_RS16335 pncB 3115957..3117429 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  FCJ76_RS16340 pncA 3117445..3117996 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  FCJ76_RS16345 yueI 3118093..3118491 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=361156 FCJ76_RS16315 WP_003220708.1 3113644..3113784(-) (degQ) [Bacillus subtilis strain H19]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=361156 FCJ76_RS16315 WP_003220708.1 3113644..3113784(-) (degQ) [Bacillus subtilis strain H19]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment