Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   FCJ76_RS12390 Genome accession   NZ_CP039935
Coordinates   2406785..2407168 (-) Length   127 a.a.
NCBI ID   WP_128738019.1    Uniprot ID   -
Organism   Bacillus subtilis strain H19     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2401785..2412168
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FCJ76_RS12350 sinI 2402718..2402891 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  FCJ76_RS12355 sinR 2402925..2403260 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  FCJ76_RS12360 tasA 2403353..2404138 (-) 786 WP_128738018.1 biofilm matrix protein TasA -
  FCJ76_RS12365 sipW 2404202..2404774 (-) 573 WP_128738626.1 signal peptidase I SipW -
  FCJ76_RS12370 tapA 2404758..2405519 (-) 762 WP_101169542.1 amyloid fiber anchoring/assembly protein TapA -
  FCJ76_RS12375 yqzG 2405792..2406118 (+) 327 WP_024573388.1 YqzG/YhdC family protein -
  FCJ76_RS12380 spoIITA 2406160..2406339 (-) 180 WP_014480252.1 YqzE family protein -
  FCJ76_RS12385 comGG 2406410..2406784 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  FCJ76_RS12390 comGF 2406785..2407168 (-) 384 WP_128738019.1 ComG operon protein ComGF Machinery gene
  FCJ76_RS12395 comGE 2407194..2407541 (-) 348 WP_128738020.1 ComG operon protein 5 Machinery gene
  FCJ76_RS12400 comGD 2407525..2407956 (-) 432 WP_024573390.1 comG operon protein ComGD Machinery gene
  FCJ76_RS12405 comGC 2407946..2408242 (-) 297 WP_024573391.1 comG operon protein ComGC Machinery gene
  FCJ76_RS12410 comGB 2408256..2409293 (-) 1038 WP_128738021.1 comG operon protein ComGB Machinery gene
  FCJ76_RS12415 comGA 2409280..2410350 (-) 1071 WP_128738022.1 competence protein ComGA Machinery gene
  FCJ76_RS21530 - 2410561..2410686 (-) 126 WP_003230155.1 hypothetical protein -
  FCJ76_RS12425 corA 2410752..2411705 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14354.51 Da        Isoelectric Point: 6.3242

>NTDB_id=361135 FCJ76_RS12390 WP_128738019.1 2406785..2407168(-) (comGF) [Bacillus subtilis strain H19]
MLISGSLAAIFHLFLSRQQEYDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=361135 FCJ76_RS12390 WP_128738019.1 2406785..2407168(-) (comGF) [Bacillus subtilis strain H19]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAATATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment