Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   FCJ76_RS12350 Genome accession   NZ_CP039935
Coordinates   2402718..2402891 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain H19     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2397718..2407891
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FCJ76_RS12335 gcvT 2398517..2399605 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  FCJ76_RS12340 hepAA 2400047..2401720 (+) 1674 WP_124058586.1 SNF2-related protein -
  FCJ76_RS12345 yqhG 2401741..2402535 (+) 795 WP_003230200.1 YqhG family protein -
  FCJ76_RS12350 sinI 2402718..2402891 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  FCJ76_RS12355 sinR 2402925..2403260 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  FCJ76_RS12360 tasA 2403353..2404138 (-) 786 WP_128738018.1 biofilm matrix protein TasA -
  FCJ76_RS12365 sipW 2404202..2404774 (-) 573 WP_128738626.1 signal peptidase I SipW -
  FCJ76_RS12370 tapA 2404758..2405519 (-) 762 WP_101169542.1 amyloid fiber anchoring/assembly protein TapA -
  FCJ76_RS12375 yqzG 2405792..2406118 (+) 327 WP_024573388.1 YqzG/YhdC family protein -
  FCJ76_RS12380 spoIITA 2406160..2406339 (-) 180 WP_014480252.1 YqzE family protein -
  FCJ76_RS12385 comGG 2406410..2406784 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  FCJ76_RS12390 comGF 2406785..2407168 (-) 384 WP_128738019.1 ComG operon protein ComGF Machinery gene
  FCJ76_RS12395 comGE 2407194..2407541 (-) 348 WP_128738020.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=361132 FCJ76_RS12350 WP_003230187.1 2402718..2402891(+) (sinI) [Bacillus subtilis strain H19]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=361132 FCJ76_RS12350 WP_003230187.1 2402718..2402891(+) (sinI) [Bacillus subtilis strain H19]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment