Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   SB21_RS14850 Genome accession   NZ_CP039380
Coordinates   3003132..3003272 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain LPL-K103     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2998132..3008272
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SB21_RS14825 (SB21_14825) - 2998428..2998811 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  SB21_RS14830 (SB21_14830) comA 2998833..2999477 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  SB21_RS14835 (SB21_14835) comP 2999558..3001867 (-) 2310 WP_033574914.1 histidine kinase Regulator
  SB21_RS14840 (SB21_14840) comX 3001887..3002063 (-) 177 WP_007408675.1 competence pheromone ComX -
  SB21_RS14845 (SB21_14845) comQ 3002063..3003001 (-) 939 WP_020954300.1 polyprenyl synthetase family protein Regulator
  SB21_RS14850 (SB21_14850) degQ 3003132..3003272 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  SB21_RS14860 (SB21_14860) - 3003738..3004079 (+) 342 WP_015418107.1 hypothetical protein -
  SB21_RS14865 (SB21_14865) - 3004086..3005309 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  SB21_RS14870 (SB21_14870) - 3005439..3006905 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  SB21_RS14875 (SB21_14875) - 3006923..3007474 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  SB21_RS14880 (SB21_14880) - 3007571..3007969 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=358365 SB21_RS14850 WP_003152043.1 3003132..3003272(-) (degQ) [Bacillus velezensis strain LPL-K103]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=358365 SB21_RS14850 WP_003152043.1 3003132..3003272(-) (degQ) [Bacillus velezensis strain LPL-K103]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment