Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | GRT08_RS11945 | Genome accession | NZ_CP047234 |
| Coordinates | 2468886..2469059 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain FJ4 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2463886..2474059
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GRT08_RS11930 (GRT08_11760) | gcvT | 2464703..2465803 (-) | 1101 | WP_071391617.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| GRT08_RS11935 (GRT08_11765) | - | 2466227..2467897 (+) | 1671 | WP_046559872.1 | DEAD/DEAH box helicase | - |
| GRT08_RS11940 (GRT08_11770) | - | 2467915..2468709 (+) | 795 | WP_071391615.1 | YqhG family protein | - |
| GRT08_RS11945 (GRT08_11775) | sinI | 2468886..2469059 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| GRT08_RS11950 (GRT08_11780) | sinR | 2469093..2469428 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| GRT08_RS11955 (GRT08_11785) | tasA | 2469476..2470261 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| GRT08_RS11960 (GRT08_11790) | sipW | 2470325..2470909 (-) | 585 | WP_060562614.1 | signal peptidase I SipW | - |
| GRT08_RS11965 (GRT08_11795) | tapA | 2470881..2471552 (-) | 672 | WP_071391613.1 | amyloid fiber anchoring/assembly protein TapA | - |
| GRT08_RS11970 (GRT08_11800) | - | 2471811..2472140 (+) | 330 | WP_071391612.1 | DUF3889 domain-containing protein | - |
| GRT08_RS11975 (GRT08_11805) | - | 2472180..2472359 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| GRT08_RS11980 (GRT08_11810) | comGG | 2472416..2472793 (-) | 378 | WP_071391611.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| GRT08_RS11985 (GRT08_11815) | comGF | 2472794..2473189 (-) | 396 | WP_071391610.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| GRT08_RS11990 (GRT08_11820) | comGE | 2473203..2473517 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| GRT08_RS11995 (GRT08_11825) | comGD | 2473501..2473938 (-) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=358362 GRT08_RS11945 WP_003153105.1 2468886..2469059(+) (sinI) [Bacillus amyloliquefaciens strain FJ4]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=358362 GRT08_RS11945 WP_003153105.1 2468886..2469059(+) (sinI) [Bacillus amyloliquefaciens strain FJ4]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |