Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GRT08_RS11945 Genome accession   NZ_CP047234
Coordinates   2468886..2469059 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain FJ4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2463886..2474059
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GRT08_RS11930 (GRT08_11760) gcvT 2464703..2465803 (-) 1101 WP_071391617.1 glycine cleavage system aminomethyltransferase GcvT -
  GRT08_RS11935 (GRT08_11765) - 2466227..2467897 (+) 1671 WP_046559872.1 DEAD/DEAH box helicase -
  GRT08_RS11940 (GRT08_11770) - 2467915..2468709 (+) 795 WP_071391615.1 YqhG family protein -
  GRT08_RS11945 (GRT08_11775) sinI 2468886..2469059 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  GRT08_RS11950 (GRT08_11780) sinR 2469093..2469428 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GRT08_RS11955 (GRT08_11785) tasA 2469476..2470261 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  GRT08_RS11960 (GRT08_11790) sipW 2470325..2470909 (-) 585 WP_060562614.1 signal peptidase I SipW -
  GRT08_RS11965 (GRT08_11795) tapA 2470881..2471552 (-) 672 WP_071391613.1 amyloid fiber anchoring/assembly protein TapA -
  GRT08_RS11970 (GRT08_11800) - 2471811..2472140 (+) 330 WP_071391612.1 DUF3889 domain-containing protein -
  GRT08_RS11975 (GRT08_11805) - 2472180..2472359 (-) 180 WP_003153093.1 YqzE family protein -
  GRT08_RS11980 (GRT08_11810) comGG 2472416..2472793 (-) 378 WP_071391611.1 competence type IV pilus minor pilin ComGG Machinery gene
  GRT08_RS11985 (GRT08_11815) comGF 2472794..2473189 (-) 396 WP_071391610.1 competence type IV pilus minor pilin ComGF Machinery gene
  GRT08_RS11990 (GRT08_11820) comGE 2473203..2473517 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  GRT08_RS11995 (GRT08_11825) comGD 2473501..2473938 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=358362 GRT08_RS11945 WP_003153105.1 2468886..2469059(+) (sinI) [Bacillus amyloliquefaciens strain FJ4]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=358362 GRT08_RS11945 WP_003153105.1 2468886..2469059(+) (sinI) [Bacillus amyloliquefaciens strain FJ4]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment