Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   GQY29_RS04980 Genome accession   NZ_CP047191
Coordinates   924526..924765 (+) Length   79 a.a.
NCBI ID   WP_011681565.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain EU01     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 919526..929765
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GQY29_RS10715 comD/blpH 919566..920369 (-) 804 WP_223899638.1 ATP-binding protein Regulator
  GQY29_RS04950 (GQY29_04950) - 920900..921637 (-) 738 WP_011681571.1 response regulator transcription factor -
  GQY29_RS04955 (GQY29_04955) - 921887..922063 (+) 177 WP_011681570.1 Blp family class II bacteriocin -
  GQY29_RS04960 (GQY29_04960) - 922082..922282 (+) 201 WP_011681569.1 hypothetical protein -
  GQY29_RS04965 (GQY29_04965) - 922639..922869 (+) 231 WP_014608662.1 bacteriocin class II family protein -
  GQY29_RS10345 - 922876..923019 (+) 144 WP_014608661.1 hypothetical protein -
  GQY29_RS11115 (GQY29_04975) - 923874..924275 (+) 402 WP_011226490.1 hypothetical protein -
  GQY29_RS04980 (GQY29_04980) cipB 924526..924765 (+) 240 WP_011681565.1 Blp family class II bacteriocin Regulator
  GQY29_RS04985 (GQY29_04985) - 924777..925169 (+) 393 WP_003094909.1 hypothetical protein -
  GQY29_RS04990 (GQY29_04990) - 925198..925377 (+) 180 WP_011681564.1 hypothetical protein -
  GQY29_RS04995 (GQY29_04995) - 925561..926253 (+) 693 WP_224103184.1 thioredoxin family protein -
  GQY29_RS05000 (GQY29_05000) - 926284..926490 (+) 207 WP_011681562.1 hypothetical protein -
  GQY29_RS05005 (GQY29_05005) - 926655..926951 (+) 297 WP_004197070.1 bacteriocin immunity protein -
  GQY29_RS05010 (GQY29_05010) - 927273..927536 (+) 264 WP_002945924.1 hypothetical protein -
  GQY29_RS05015 (GQY29_05015) - 927661..928041 (+) 381 WP_002951783.1 hypothetical protein -

Sequence

Protein


Download         Length: 79 a.a.        Molecular weight: 7727.69 Da        Isoelectric Point: 3.8735

>NTDB_id=357906 GQY29_RS04980 WP_011681565.1 924526..924765(+) (cipB) [Streptococcus thermophilus strain EU01]
MATQTIENFNTLDLETLASVEGGRVNWERWGMCGASVAVGASEGFSAAAGGTAFFIGPYAIGTGAVGAAIGGGVALLGC

Nucleotide


Download         Length: 240 bp        

>NTDB_id=357906 GQY29_RS04980 WP_011681565.1 924526..924765(+) (cipB) [Streptococcus thermophilus strain EU01]
ATGGCAACTCAAACAATTGAAAACTTTAACACCCTCGACCTTGAAACACTTGCTAGTGTTGAAGGAGGACGAGTCAATTG
GGAACGATGGGGAATGTGTGGGGCCTCTGTCGCCGTAGGTGCTTCAGAAGGATTCTCTGCAGCTGCAGGTGGAACGGCTT
TCTTCATTGGACCGTATGCAATTGGAACTGGTGCAGTAGGTGCAGCTATTGGAGGTGGAGTAGCCTTACTTGGCTGTTAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(7-74)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.459

77.215

0.405