Detailed information NTG0357749

Bioinformatically predicted

Overview

• Name: chpA
• Type: Regulator
• Locus tag: E6P07_RS13665
• Genome accession: NZ_CP039268
• Coordinates: 2955238..2955459 (-)
• Length: 73 a.a.
• NCBI ID: WP_170286772.1
• Uniprot ID: -
• Organism: Thermochromatium tepidum ATCC 43061
• Function: regulation of type IV pilus assembly (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	2954245..2954505	2955238..2955459	flank	733

Gene organization within MGE regions

Location: 2954245..2955459

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
E6P07_RS13550 (E6P07_13550)	-	2954697..2955167 (-)	471	WP_153976092.1	CZB domain-containing protein	-
E6P07_RS13665	chpA	2955238..2955459 (-)	222	WP_170286772.1	response regulator	Regulator

Sequence

Protein

• Length: 73 a.a.
• Molecular weight: 8317.56 Da
• Isoelectric Point: 4.7483

>NTDB_id=357749 E6P07_RS13665 WP_170286772.1 2955238..2955459(-) (chpA) [Thermochromatium tepidum ATCC 43061]
MVTAKDGVDALEQLIEIEPDVTLLDIEMPHMDGFDLTKRLRQDSKTRALLINMITSRPANKHRNYVPELGVNE

Nucleotide

• Length: 222 bp

>NTDB_id=357749 E6P07_RS13665 WP_170286772.1 2955238..2955459(-) (chpA) [Thermochromatium tepidum ATCC 43061]
ATGGTCACCGCCAAGGACGGGGTGGATGCGTTGGAGCAGTTGATAGAGATCGAACCGGACGTTACGCTGCTCGATATCGA
GATGCCGCACATGGATGGCTTTGATCTGACCAAGCGCCTGCGCCAGGACAGCAAAACGCGCGCGTTGCTAATCAACATGA
TCACCTCGCGCCCAGCAAACAAGCACCGTAACTATGTGCCGGAACTCGGTGTTAACGAATAA

Domains

Predicted by InterproScan.

• Response regulator receiver domain (Response_reg) (3-71)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
chpA	Acinetobacter baumannii strain A118	53.425	100	0.534
pilL-C	Synechocystis sp. PCC 6803	42.857	95.89	0.411