Detailed information NTG0354533

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: SaO322_RS07740
• Genome accession: NZ_CP038460
• Coordinates: 1550588..1550899 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain B119
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1545588..1555899

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SaO322_RS07705 (SaO322_01422)	gcvPA	1546091..1547437 (-)	1347	WP_000019697.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
SaO322_RS07710 (SaO322_01423)	gcvT	1547457..1548548 (-)	1092	WP_000093343.1	glycine cleavage system aminomethyltransferase GcvT	-
SaO322_RS07715 (SaO322_01424)	-	1548706..1549230 (-)	525	WP_001015120.1	shikimate kinase	-
SaO322_RS07720	-	1549220..1549366 (-)	147	WP_001789879.1	hypothetical protein	-
SaO322_RS07725 (SaO322_01425)	comGF	1549463..1549960 (-)	498	WP_078061106.1	competence type IV pilus minor pilin ComGF	Machinery gene
SaO322_RS07730 (SaO322_01426)	comGE	1549878..1550177 (-)	300	WP_000844409.1	hypothetical protein	Machinery gene
SaO322_RS07735 (SaO322_01427)	comGD	1550164..1550610 (-)	447	WP_118848117.1	competence type IV pilus minor pilin ComGD	Machinery gene
SaO322_RS07740 (SaO322_01428)	comGC	1550588..1550899 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
SaO322_RS07745 (SaO322_01429)	comGB	1550913..1551983 (-)	1071	WP_000776418.1	competence type IV pilus assembly protein ComGB	Machinery gene
SaO322_RS07750 (SaO322_01430)	comGA	1551955..1552929 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
SaO322_RS07755 (SaO322_01431)	-	1552981..1553604 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
SaO322_RS07760 (SaO322_01432)	-	1553601..1553930 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
SaO322_RS07765 (SaO322_01433)	-	1553930..1554916 (-)	987	WP_118848118.1	ROK family glucokinase	-
SaO322_RS07770	-	1554913..1555116 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=354533 SaO322_RS07740 WP_000472256.1 1550588..1550899(-) (comGC) [Staphylococcus aureus strain B119]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=354533 SaO322_RS07740 WP_000472256.1 1550588..1550899(-) (comGC) [Staphylococcus aureus strain B119]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369