Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | GO004_RS01220 | Genome accession | NZ_CP046591 |
| Coordinates | 199201..199374 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis strain R31 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 194201..204374
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GO004_RS01175 (GO004_01165) | comGE | 194553..194900 (+) | 348 | WP_015714254.1 | ComG operon protein 5 | Machinery gene |
| GO004_RS01180 (GO004_01170) | comGF | 194926..195309 (+) | 384 | WP_195727813.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| GO004_RS01185 (GO004_01175) | comGG | 195310..195684 (+) | 375 | WP_029726722.1 | ComG operon protein ComGG | Machinery gene |
| GO004_RS01190 (GO004_01180) | spoIITA | 195756..195935 (+) | 180 | WP_029726723.1 | YqzE family protein | - |
| GO004_RS01195 (GO004_01185) | yqzG | 195977..196303 (-) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| GO004_RS01200 (GO004_01190) | tapA | 196573..197334 (+) | 762 | WP_029726724.1 | amyloid fiber anchoring/assembly protein TapA | - |
| GO004_RS01205 (GO004_01195) | sipW | 197318..197890 (+) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| GO004_RS01210 (GO004_01200) | tasA | 197954..198739 (+) | 786 | WP_014664586.1 | biofilm matrix protein TasA | - |
| GO004_RS01215 (GO004_01205) | sinR | 198832..199167 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| GO004_RS01220 (GO004_01210) | sinI | 199201..199374 (-) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| GO004_RS01225 (GO004_01215) | yqhG | 199557..200351 (-) | 795 | WP_003230200.1 | YqhG family protein | - |
| GO004_RS01230 (GO004_01220) | hepAA | 200372..202045 (-) | 1674 | WP_029726726.1 | SNF2-related protein | - |
| GO004_RS01235 (GO004_01225) | gcvT | 202487..203575 (+) | 1089 | WP_015714248.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=353540 GO004_RS01220 WP_003230187.1 199201..199374(-) (sinI) [Bacillus subtilis strain R31]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=353540 GO004_RS01220 WP_003230187.1 199201..199374(-) (sinI) [Bacillus subtilis strain R31]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |