Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GO004_RS01220 Genome accession   NZ_CP046591
Coordinates   199201..199374 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain R31     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 194201..204374
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GO004_RS01175 (GO004_01165) comGE 194553..194900 (+) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  GO004_RS01180 (GO004_01170) comGF 194926..195309 (+) 384 WP_195727813.1 competence type IV pilus minor pilin ComGF Machinery gene
  GO004_RS01185 (GO004_01175) comGG 195310..195684 (+) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GO004_RS01190 (GO004_01180) spoIITA 195756..195935 (+) 180 WP_029726723.1 YqzE family protein -
  GO004_RS01195 (GO004_01185) yqzG 195977..196303 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  GO004_RS01200 (GO004_01190) tapA 196573..197334 (+) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GO004_RS01205 (GO004_01195) sipW 197318..197890 (+) 573 WP_003246088.1 signal peptidase I SipW -
  GO004_RS01210 (GO004_01200) tasA 197954..198739 (+) 786 WP_014664586.1 biofilm matrix protein TasA -
  GO004_RS01215 (GO004_01205) sinR 198832..199167 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GO004_RS01220 (GO004_01210) sinI 199201..199374 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  GO004_RS01225 (GO004_01215) yqhG 199557..200351 (-) 795 WP_003230200.1 YqhG family protein -
  GO004_RS01230 (GO004_01220) hepAA 200372..202045 (-) 1674 WP_029726726.1 SNF2-related protein -
  GO004_RS01235 (GO004_01225) gcvT 202487..203575 (+) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=353540 GO004_RS01220 WP_003230187.1 199201..199374(-) (sinI) [Bacillus subtilis strain R31]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=353540 GO004_RS01220 WP_003230187.1 199201..199374(-) (sinI) [Bacillus subtilis strain R31]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1