Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   GO004_RS01180 Genome accession   NZ_CP046591
Coordinates   194926..195309 (+) Length   127 a.a.
NCBI ID   WP_195727813.1    Uniprot ID   -
Organism   Bacillus subtilis strain R31     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 189926..200309
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GO004_RS01145 (GO004_01135) corA 190380..191333 (+) 954 WP_004399136.1 magnesium transporter CorA -
  GO004_RS01150 (GO004_01140) - 191335..191532 (+) 198 WP_014480259.1 CBS domain-containing protein -
  GO004_RS01155 (GO004_01145) comGA 191744..192814 (+) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  GO004_RS01160 (GO004_01150) comGB 192801..193838 (+) 1038 WP_015714257.1 comG operon protein ComGB Machinery gene
  GO004_RS01165 (GO004_01155) comGC 193852..194148 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  GO004_RS01170 (GO004_01160) comGD 194138..194569 (+) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  GO004_RS01175 (GO004_01165) comGE 194553..194900 (+) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  GO004_RS01180 (GO004_01170) comGF 194926..195309 (+) 384 WP_195727813.1 competence type IV pilus minor pilin ComGF Machinery gene
  GO004_RS01185 (GO004_01175) comGG 195310..195684 (+) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GO004_RS01190 (GO004_01180) spoIITA 195756..195935 (+) 180 WP_029726723.1 YqzE family protein -
  GO004_RS01195 (GO004_01185) yqzG 195977..196303 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  GO004_RS01200 (GO004_01190) tapA 196573..197334 (+) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GO004_RS01205 (GO004_01195) sipW 197318..197890 (+) 573 WP_003246088.1 signal peptidase I SipW -
  GO004_RS01210 (GO004_01200) tasA 197954..198739 (+) 786 WP_014664586.1 biofilm matrix protein TasA -
  GO004_RS01215 (GO004_01205) sinR 198832..199167 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GO004_RS01220 (GO004_01210) sinI 199201..199374 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14448.54 Da        Isoelectric Point: 6.2135

>NTDB_id=353537 GO004_RS01180 WP_195727813.1 194926..195309(+) (comGF) [Bacillus subtilis strain R31]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSRQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=353537 GO004_RS01180 WP_195727813.1 194926..195309(+) (comGF) [Bacillus subtilis strain R31]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCAGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment