Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPELS_RS00210 Genome accession   NC_017063
Coordinates   37715..37828 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori ELS37     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32715..42828
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPELS_RS00185 (HPELS_00155) - 32772..34997 (+) 2226 WP_001051478.1 AAA family ATPase -
  HPELS_RS00190 (HPELS_00160) panD 34987..35337 (+) 351 WP_000142295.1 aspartate 1-decarboxylase -
  HPELS_RS00195 (HPELS_00165) - 35348..35641 (+) 294 WP_000347919.1 YbaB/EbfC family nucleoid-associated protein -
  HPELS_RS00200 (HPELS_00170) - 35641..36636 (+) 996 WP_000468496.1 PDZ domain-containing protein -
  HPELS_RS00205 (HPELS_00175) comB6 36644..37699 (+) 1056 WP_000786648.1 P-type conjugative transfer protein TrbL Machinery gene
  HPELS_RS00210 (HPELS_00180) comB7 37715..37828 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HPELS_RS00215 (HPELS_00185) comB8 37825..38568 (+) 744 WP_001208413.1 type IV secretion system protein Machinery gene
  HPELS_RS00220 (HPELS_00190) comB9 38568..39542 (+) 975 WP_014419477.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPELS_RS00225 (HPELS_00195) comB10 39535..40665 (+) 1131 WP_001045890.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPELS_RS00230 (HPELS_00200) - 40736..42148 (+) 1413 WP_000694959.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=35276 HPELS_RS00210 WP_001217873.1 37715..37828(+) (comB7) [Helicobacter pylori ELS37]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=35276 HPELS_RS00210 WP_001217873.1 37715..37828(+) (comB7) [Helicobacter pylori ELS37]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment