Detailed information    

insolico Bioinformatically predicted

Overview

Name   clpX   Type   Regulator
Locus tag   ES298_RS07470 Genome accession   NZ_CP038253
Coordinates   1477905..1479137 (-) Length   410 a.a.
NCBI ID   WP_000106349.1    Uniprot ID   A0AA95D8Q6
Organism   Streptococcus pneumoniae strain TVO_1901929     
Function   require for competence development (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1425174..1488190 1477905..1479137 within 0


Gene organization within MGE regions


Location: 1425174..1488190
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES298_RS07125 (ES298_07525) - 1425174..1426373 (-) 1200 WP_001858603.1 CCA tRNA nucleotidyltransferase -
  ES298_RS07130 (ES298_07530) dapB 1426370..1427137 (-) 768 WP_000027897.1 4-hydroxy-tetrahydrodipicolinate reductase -
  ES298_RS07135 (ES298_07535) - 1427403..1428251 (-) 849 WP_000762061.1 DegV family protein -
  ES298_RS07140 (ES298_07540) - 1428253..1428627 (-) 375 WP_001050086.1 DUF1149 family protein -
  ES298_RS07145 (ES298_07545) glmM 1428701..1430053 (-) 1353 WP_000521418.1 phosphoglucosamine mutase -
  ES298_RS07150 - 1430077..1430874 (-) 798 WP_029645266.1 YbbR-like domain-containing protein -
  ES298_RS07155 cdaA 1430848..1431699 (-) 852 Protein_1434 diadenylate cyclase CdaA -
  ES298_RS07160 (ES298_07560) - 1431835..1432803 (+) 969 WP_000081003.1 NAD(P)/FAD-dependent oxidoreductase -
  ES298_RS07165 (ES298_07570) - 1433056..1434012 (-) 957 WP_000350525.1 N-acetylmuramoyl-L-alanine amidase family protein -
  ES298_RS07170 (ES298_07575) - 1434012..1434347 (-) 336 WP_001186239.1 phage holin -
  ES298_RS07175 (ES298_07580) - 1434351..1434650 (-) 300 WP_001810279.1 hypothetical protein -
  ES298_RS07180 (ES298_07585) - 1434660..1435010 (-) 351 WP_000852249.1 hypothetical protein -
  ES298_RS07185 (ES298_07590) - 1435013..1435216 (-) 204 WP_001091119.1 hypothetical protein -
  ES298_RS11305 (ES298_07595) - 1435197..1435313 (-) 117 Protein_1441 dihydrodipicolinate reductase -
  ES298_RS07190 - 1435310..1441753 (-) 6444 WP_000339678.1 tail fiber domain-containing protein -
  ES298_RS07195 (ES298_07610) - 1441758..1442108 (-) 351 WP_000068023.1 DUF6711 family protein -
  ES298_RS07200 (ES298_07615) - 1442117..1445710 (-) 3594 WP_000212166.1 hypothetical protein -
  ES298_RS07205 (ES298_07620) - 1445697..1446047 (-) 351 WP_000478007.1 hypothetical protein -
  ES298_RS07210 (ES298_07625) - 1446086..1446466 (-) 381 WP_001185631.1 DUF6096 family protein -
  ES298_RS07215 (ES298_07630) - 1446471..1446884 (-) 414 WP_000880665.1 phage tail tube protein -
  ES298_RS07220 (ES298_07635) - 1446887..1447255 (-) 369 WP_000608235.1 hypothetical protein -
  ES298_RS07225 (ES298_07640) - 1447252..1447767 (-) 516 WP_000015940.1 HK97-gp10 family putative phage morphogenesis protein -
  ES298_RS07230 (ES298_07645) - 1447742..1448080 (-) 339 WP_000478943.1 hypothetical protein -
  ES298_RS07235 (ES298_07650) - 1448061..1448372 (-) 312 WP_000021218.1 phage head-tail connector protein -
  ES298_RS07240 (ES298_07655) - 1448374..1448562 (-) 189 WP_000669348.1 hypothetical protein -
  ES298_RS07245 (ES298_07660) - 1448572..1449597 (-) 1026 WP_000863393.1 carbohydrate-binding protein -
  ES298_RS07250 (ES298_07665) - 1449620..1450144 (-) 525 WP_001288018.1 DUF4355 domain-containing protein -
  ES298_RS07255 - 1450411..1450584 (-) 174 WP_000356388.1 hypothetical protein -
  ES298_RS07260 (ES298_07670) - 1450626..1451039 (-) 414 WP_000565273.1 HD domain-containing protein -
  ES298_RS07265 (ES298_07675) - 1451036..1451245 (-) 210 WP_000651747.1 hypothetical protein -
  ES298_RS07270 (ES298_07680) - 1451247..1452884 (-) 1638 WP_238099887.1 minor capsid protein -
  ES298_RS07275 (ES298_07685) - 1452793..1454262 (-) 1470 WP_000285392.1 phage portal protein -
  ES298_RS07280 (ES298_07690) - 1454274..1455572 (-) 1299 WP_000084412.1 PBSX family phage terminase large subunit -
  ES298_RS07285 (ES298_07695) - 1455550..1456062 (-) 513 WP_000863690.1 terminase small subunit -
  ES298_RS07295 (ES298_07700) - 1457332..1457754 (-) 423 WP_001030244.1 DUF1492 domain-containing protein -
  ES298_RS07300 (ES298_07705) - 1457872..1458189 (-) 318 WP_001268499.1 hypothetical protein -
  ES298_RS07305 (ES298_07710) - 1458251..1458778 (-) 528 WP_001041163.1 DUF1642 domain-containing protein -
  ES298_RS07310 (ES298_07715) - 1458780..1459094 (-) 315 WP_000391853.1 hypothetical protein -
  ES298_RS07315 (ES298_07720) - 1459245..1459583 (-) 339 WP_000119453.1 hypothetical protein -
  ES298_RS07320 - 1459583..1459735 (-) 153 WP_000122743.1 hypothetical protein -
  ES298_RS07325 (ES298_07725) - 1460028..1461371 (-) 1344 WP_000580029.1 virulence-associated E family protein -
  ES298_RS07330 (ES298_07730) - 1461374..1462195 (-) 822 WP_000097191.1 bifunctional DNA primase/polymerase -
  ES298_RS07335 (ES298_07735) - 1462368..1462871 (-) 504 WP_000054337.1 hypothetical protein -
  ES298_RS07340 (ES298_07740) - 1462891..1463667 (-) 777 WP_000885998.1 AAA family ATPase -
  ES298_RS07345 (ES298_07745) - 1463667..1463984 (-) 318 WP_001044592.1 hypothetical protein -
  ES298_RS07350 (ES298_07750) - 1464003..1465196 (-) 1194 WP_000028860.1 DEAD/DEAH box helicase family protein -
  ES298_RS07355 (ES298_07755) - 1465159..1465644 (-) 486 WP_000696057.1 hypothetical protein -
  ES298_RS07360 (ES298_07760) - 1465644..1466003 (-) 360 WP_000422308.1 hypothetical protein -
  ES298_RS07365 (ES298_07765) - 1466003..1466485 (-) 483 WP_000157805.1 siphovirus Gp157 family protein -
  ES298_RS07370 (ES298_07770) - 1466478..1467200 (-) 723 WP_000544342.1 HNH endonuclease signature motif containing protein -
  ES298_RS07375 (ES298_07775) - 1467214..1467444 (-) 231 WP_000252078.1 hypothetical protein -
  ES298_RS07380 (ES298_07780) - 1467445..1467786 (-) 342 WP_000189400.1 hypothetical protein -
  ES298_RS07385 (ES298_07785) - 1467798..1467989 (-) 192 WP_000970850.1 hypothetical protein -
  ES298_RS07390 (ES298_07790) - 1467986..1468180 (-) 195 WP_001050924.1 hypothetical protein -
  ES298_RS07395 (ES298_07795) - 1468177..1468449 (-) 273 WP_000454230.1 hypothetical protein -
  ES298_RS07400 (ES298_07800) - 1468790..1468981 (+) 192 WP_000834564.1 hypothetical protein -
  ES298_RS07405 (ES298_07810) - 1469164..1469355 (-) 192 WP_001112859.1 DNA-binding protein -
  ES298_RS07410 (ES298_07815) - 1469420..1469659 (+) 240 WP_000142893.1 hypothetical protein -
  ES298_RS07415 (ES298_07820) - 1469883..1469972 (+) 90 WP_001810072.1 hypothetical protein -
  ES298_RS07420 (ES298_07825) - 1470195..1470287 (+) 93 WP_000970295.1 type I toxin-antitoxin system Fst family toxin -
  ES298_RS07425 (ES298_07830) - 1470685..1471038 (+) 354 WP_000493111.1 helix-turn-helix domain-containing protein -
  ES298_RS07430 (ES298_07835) - 1471040..1472134 (+) 1095 WP_000156313.1 hypothetical protein -
  ES298_RS07435 (ES298_07840) - 1472357..1472737 (+) 381 WP_000151192.1 ImmA/IrrE family metallo-endopeptidase -
  ES298_RS07440 (ES298_07845) - 1472879..1474006 (+) 1128 WP_000266847.1 site-specific integrase -
  ES298_RS07445 (ES298_07850) whiA 1474094..1475005 (-) 912 WP_000011306.1 DNA-binding protein WhiA -
  ES298_RS07450 (ES298_07855) - 1475002..1475979 (-) 978 WP_001231086.1 YvcK family protein -
  ES298_RS07455 (ES298_07860) rapZ 1475976..1476866 (-) 891 WP_000163035.1 RNase adapter RapZ -
  ES298_RS07460 (ES298_07865) - 1476918..1477298 (-) 381 WP_001140412.1 RidA family protein -
  ES298_RS07465 (ES298_07870) yihA 1477309..1477896 (-) 588 WP_000422599.1 ribosome biogenesis GTP-binding protein YihA/YsxC -
  ES298_RS07470 (ES298_07875) clpX 1477905..1479137 (-) 1233 WP_000106349.1 ATP-dependent Clp protease ATP-binding subunit ClpX Regulator
  ES298_RS07475 (ES298_07880) - 1479169..1479339 (-) 171 WP_000442275.1 hypothetical protein -
  ES298_RS07480 (ES298_07885) - 1479339..1479845 (-) 507 WP_000162451.1 dihydrofolate reductase -
  ES298_RS07485 (ES298_07890) - 1479975..1480493 (-) 519 WP_000229856.1 DNA starvation/stationary phase protection protein -
  ES298_RS07490 (ES298_07895) lytC 1480991..1482496 (-) 1506 WP_078139284.1 choline binding-anchored murein hydrolase LytC -
  ES298_RS07495 (ES298_07900) tpiA 1482534..1483292 (-) 759 WP_000087897.1 triose-phosphate isomerase -
  ES298_RS07500 (ES298_07905) - 1483390..1484067 (-) 678 WP_000221614.1 DnaD domain-containing protein -
  ES298_RS07505 (ES298_07910) metA 1484076..1485020 (-) 945 WP_001122712.1 homoserine O-succinyltransferase -
  ES298_RS07510 (ES298_07915) - 1485202..1485714 (-) 513 WP_001049323.1 adenine phosphoribosyltransferase -
  ES298_RS07515 (ES298_07920) - 1485801..1486559 (-) 759 WP_001287230.1 class I SAM-dependent methyltransferase -
  ES298_RS07520 - 1486767..1486913 (+) 147 WP_000403100.1 hypothetical protein -
  ES298_RS07525 (ES298_07925) - 1487060..1488190 (-) 1131 WP_000229961.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 410 a.a.        Molecular weight: 45816.38 Da        Isoelectric Point: 4.4550

>NTDB_id=352706 ES298_RS07470 WP_000106349.1 1477905..1479137(-) (clpX) [Streptococcus pneumoniae strain TVO_1901929]
MSTNRKNDMMVYCSFCGKNQEEVQKIIAGNNAFICNECVELAQEIIREELVEEVLADLSEVPKPIELLHILNHYVIGQDR
AKRALAVAVYNHYKRINFHDTREESEDVDLQKSNILMIGPTGSGKTFLAQTLAKSLNVPFAIADATALTEAGYVGEDVEN
ILLKLLQVADFNIERAERGIIYVDEIDKIAKKSENVSITRDVSGEGVQQALLKIIEGTVASVPPQGGRKHPQQEMIQVDT
KNILFIVGGAFDGIEEIVKQRMGEKVIGFGQNNKAIDENSSYMQEIIAEDIQKFGIIPELIGRLPVFAALEQLTVDDLVR
ILKEPRNALVKQYQTLLSYDDVELEFDDEALQEIANKAIERKTGARGLRSIIEETMLDVMFEVPSQENVKLVRITKETVD
GTDKPILETA

Nucleotide


Download         Length: 1233 bp        

>NTDB_id=352706 ES298_RS07470 WP_000106349.1 1477905..1479137(-) (clpX) [Streptococcus pneumoniae strain TVO_1901929]
ATGTCTACAAATAGAAAAAATGATATGATGGTTTATTGCTCATTTTGTGGCAAAAACCAAGAAGAAGTACAAAAAATAAT
TGCTGGCAACAATGCTTTTATTTGTAATGAATGCGTGGAGTTAGCTCAGGAAATCATTCGAGAAGAATTGGTTGAGGAAG
TCTTGGCAGACTTGTCTGAGGTGCCAAAACCAATTGAACTCCTCCATATCTTGAACCACTATGTAATTGGTCAAGATCGT
GCCAAGCGTGCCTTGGCAGTGGCGGTTTATAACCACTACAAACGCATCAATTTCCACGATACACGCGAAGAGTCAGAAGA
TGTGGATTTGCAGAAGTCAAACATTTTGATGATTGGCCCAACTGGTTCAGGGAAAACTTTCCTTGCCCAGACCTTGGCTA
AGAGCTTGAATGTGCCTTTTGCTATTGCGGATGCGACAGCTCTGACGGAGGCTGGTTATGTGGGTGAGGACGTGGAAAAT
ATCCTCCTCAAACTCTTGCAGGTTGCTGACTTTAACATCGAACGTGCAGAGCGTGGCATTATCTATGTGGATGAAATTGA
CAAGATTGCCAAGAAGAGTGAGAATGTGTCTATCACACGTGATGTTTCTGGTGAAGGGGTGCAACAAGCCCTTCTCAAGA
TTATCGAGGGAACTGTTGCTAGCGTGCCGCCTCAAGGTGGACGCAAACATCCACAACAAGAGATGATTCAAGTGGATACA
AAAAATATCCTCTTCATCGTGGGTGGTGCTTTTGATGGTATTGAAGAAATTGTCAAACAACGTATGGGTGAAAAAGTCAT
CGGATTTGGTCAAAACAATAAGGCGATTGACGAAAACAGCTCATACATGCAAGAAATCATCGCTGAAGACATTCAAAAAT
TTGGTATTATCCCTGAGTTGATTGGACGCTTGCCTGTTTTTGCGGCTCTTGAGCAATTGACCGTTGATGACTTGGTTCGC
ATCTTGAAAGAGCCAAGAAATGCCTTGGTGAAACAATACCAAACCTTGCTTTCTTATGATGATGTTGAGTTGGAATTTGA
CGACGAAGCCCTTCAAGAGATTGCTAATAAAGCAATCGAACGGAAGACAGGGGCGCGTGGACTTCGCTCCATCATCGAAG
AAACCATGCTAGATGTCATGTTTGAGGTGCCGAGTCAGGAAAATGTGAAATTGGTTCGCATCACTAAAGAAACTGTCGAT
GGAACGGATAAACCGATTCTAGAAACAGCCTAG

Domains

Predicted by InterproScan.

AAA domain (Cdc48 subfamily) (AAA_2)

(111-306)

ClpX C4-type zinc finger (zf-C4_ClpX)

(12-48)

C-terminal, D2-small domain, of ClpB protein (ClpB_D2-small)

(313-390)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  clpX Streptococcus mutans UA159

86.341

100

0.863
  clpX Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819

56.965

98.049

0.559

Multiple sequence alignment