Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GFX43_RS09445 Genome accession   NZ_CP046448
Coordinates   1817824..1817997 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain ZD01     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1812824..1822997
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GFX43_RS09400 (GFX43_009400) comGE 1813176..1813523 (+) 348 WP_015384088.1 ComG operon protein 5 Machinery gene
  GFX43_RS09405 (GFX43_009405) comGF 1813549..1813932 (+) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  GFX43_RS09410 (GFX43_009410) comGG 1813933..1814307 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  GFX43_RS09415 (GFX43_009415) spoIITA 1814379..1814558 (+) 180 WP_003230176.1 YqzE family protein -
  GFX43_RS09420 (GFX43_009420) yqzG 1814600..1814926 (-) 327 WP_015384086.1 YqzG/YhdC family protein -
  GFX43_RS09425 (GFX43_009425) tapA 1815196..1815957 (+) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  GFX43_RS09430 (GFX43_009430) sipW 1815941..1816513 (+) 573 WP_080030740.1 signal peptidase I SipW -
  GFX43_RS09435 (GFX43_009435) tasA 1816577..1817362 (+) 786 WP_003230183.1 biofilm matrix protein TasA -
  GFX43_RS09440 (GFX43_009440) sinR 1817455..1817790 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GFX43_RS09445 (GFX43_009445) sinI 1817824..1817997 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  GFX43_RS09450 (GFX43_009450) yqhG 1818180..1818974 (-) 795 WP_003230200.1 YqhG family protein -
  GFX43_RS09455 (GFX43_009455) hepAA 1818995..1820668 (-) 1674 WP_015384082.1 SNF2-related protein -
  GFX43_RS09460 (GFX43_009460) gcvT 1821110..1822198 (+) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=352377 GFX43_RS09445 WP_003230187.1 1817824..1817997(-) (sinI) [Bacillus subtilis strain ZD01]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=352377 GFX43_RS09445 WP_003230187.1 1817824..1817997(-) (sinI) [Bacillus subtilis strain ZD01]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1