Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   GFX43_RS09405 Genome accession   NZ_CP046448
Coordinates   1813549..1813932 (+) Length   127 a.a.
NCBI ID   WP_015384087.1    Uniprot ID   -
Organism   Bacillus subtilis strain ZD01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1808549..1818932
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GFX43_RS09375 (GFX43_009375) corA 1809004..1809957 (+) 954 WP_015483432.1 magnesium transporter CorA -
  GFX43_RS09380 (GFX43_009380) comGA 1810367..1811437 (+) 1071 WP_015483431.1 competence protein ComGA Machinery gene
  GFX43_RS09385 (GFX43_009385) comGB 1811424..1812461 (+) 1038 WP_015483430.1 comG operon protein ComGB Machinery gene
  GFX43_RS09390 (GFX43_009390) comGC 1812475..1812771 (+) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  GFX43_RS09395 (GFX43_009395) comGD 1812761..1813192 (+) 432 WP_015384089.1 comG operon protein ComGD Machinery gene
  GFX43_RS09400 (GFX43_009400) comGE 1813176..1813523 (+) 348 WP_015384088.1 ComG operon protein 5 Machinery gene
  GFX43_RS09405 (GFX43_009405) comGF 1813549..1813932 (+) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  GFX43_RS09410 (GFX43_009410) comGG 1813933..1814307 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  GFX43_RS09415 (GFX43_009415) spoIITA 1814379..1814558 (+) 180 WP_003230176.1 YqzE family protein -
  GFX43_RS09420 (GFX43_009420) yqzG 1814600..1814926 (-) 327 WP_015384086.1 YqzG/YhdC family protein -
  GFX43_RS09425 (GFX43_009425) tapA 1815196..1815957 (+) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  GFX43_RS09430 (GFX43_009430) sipW 1815941..1816513 (+) 573 WP_080030740.1 signal peptidase I SipW -
  GFX43_RS09435 (GFX43_009435) tasA 1816577..1817362 (+) 786 WP_003230183.1 biofilm matrix protein TasA -
  GFX43_RS09440 (GFX43_009440) sinR 1817455..1817790 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GFX43_RS09445 (GFX43_009445) sinI 1817824..1817997 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14293.34 Da        Isoelectric Point: 5.1404

>NTDB_id=352374 GFX43_RS09405 WP_015384087.1 1813549..1813932(+) (comGF) [Bacillus subtilis strain ZD01]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEDGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=352374 GFX43_RS09405 WP_015384087.1 1813549..1813932(+) (comGF) [Bacillus subtilis strain ZD01]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGGATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCACTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984