Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LC705_RS04115 | Genome accession | NC_013199 |
| Coordinates | 852765..853250 (+) | Length | 161 a.a. |
| NCBI ID | WP_015764328.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus rhamnosus Lc 705 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 843137..884459 | 852765..853250 | within | 0 |
Gene organization within MGE regions
Location: 843137..884459
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LC705_RS04040 (LC705_00835) | - | 843137..844264 (-) | 1128 | WP_015764314.1 | tyrosine-type recombinase/integrase | - |
| LC705_RS04045 (LC705_00836) | - | 844372..844635 (-) | 264 | WP_015764315.1 | hypothetical protein | - |
| LC705_RS04050 (LC705_00837) | - | 844733..844990 (-) | 258 | WP_015764316.1 | hypothetical protein | - |
| LC705_RS04055 (LC705_00838) | - | 845225..846406 (-) | 1182 | WP_005714764.1 | restriction endonuclease subunit S | - |
| LC705_RS04060 (LC705_00839) | - | 846497..846715 (-) | 219 | WP_005712700.1 | LexA family transcriptional regulator | - |
| LC705_RS04065 (LC705_00840) | - | 846787..847452 (-) | 666 | WP_015764317.1 | LexA family transcriptional regulator | - |
| LC705_RS04070 (LC705_00841) | - | 847619..847861 (+) | 243 | WP_015764318.1 | helix-turn-helix transcriptional regulator | - |
| LC705_RS04075 (LC705_00842) | - | 847885..848589 (+) | 705 | WP_015764319.1 | phage regulatory protein/antirepressor Ant | - |
| LC705_RS04080 (LC705_00843) | - | 848590..848850 (+) | 261 | WP_015764320.1 | hypothetical protein | - |
| LC705_RS04085 (LC705_00844) | - | 848843..849148 (-) | 306 | WP_015764321.1 | hypothetical protein | - |
| LC705_RS04090 (LC705_00845) | - | 849223..849579 (+) | 357 | WP_015764322.1 | DUF771 domain-containing protein | - |
| LC705_RS16185 (LC705_00846) | - | 849579..849707 (+) | 129 | WP_015764323.1 | hypothetical protein | - |
| LC705_RS04095 (LC705_00847) | - | 849719..849937 (+) | 219 | WP_015764324.1 | hypothetical protein | - |
| LC705_RS15985 (LC705_00848) | - | 849939..850109 (+) | 171 | WP_005716154.1 | hypothetical protein | - |
| LC705_RS04100 (LC705_00849) | - | 850121..850996 (+) | 876 | WP_015764325.1 | recombinase RecT | - |
| LC705_RS04105 (LC705_00850) | - | 850932..851780 (+) | 849 | WP_286011666.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| LC705_RS04110 (LC705_00851) | - | 851796..852752 (+) | 957 | WP_015764327.1 | DnaD domain-containing protein | - |
| LC705_RS04115 (LC705_00852) | ssb | 852765..853250 (+) | 486 | WP_015764328.1 | single-stranded DNA-binding protein | Machinery gene |
| LC705_RS04120 (LC705_00853) | - | 853559..853774 (+) | 216 | WP_015764329.1 | helix-turn-helix transcriptional regulator | - |
| LC705_RS04125 (LC705_00854) | - | 853771..853962 (+) | 192 | WP_015764330.1 | helix-turn-helix domain-containing protein | - |
| LC705_RS04130 (LC705_00855) | - | 854332..854781 (+) | 450 | WP_015764331.1 | hypothetical protein | - |
| LC705_RS04135 (LC705_00856) | - | 854828..855082 (+) | 255 | WP_015764332.1 | hypothetical protein | - |
| LC705_RS04140 | - | 855079..855492 (+) | 414 | WP_015978893.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LC705_RS04145 (LC705_00857) | - | 855505..855969 (+) | 465 | WP_015764333.1 | hypothetical protein | - |
| LC705_RS04160 (LC705_00858) | - | 856351..856761 (+) | 411 | WP_015764334.1 | hypothetical protein | - |
| LC705_RS04165 (LC705_00859) | - | 856758..857198 (+) | 441 | WP_015764335.1 | hypothetical protein | - |
| LC705_RS16190 (LC705_00860) | - | 857185..857403 (+) | 219 | WP_015764336.1 | hypothetical protein | - |
| LC705_RS04175 (LC705_00861) | - | 857393..857725 (+) | 333 | WP_015764337.1 | hypothetical protein | - |
| LC705_RS04180 (LC705_00862) | - | 857722..857961 (+) | 240 | WP_014569479.1 | hypothetical protein | - |
| LC705_RS04185 (LC705_00863) | - | 857958..858350 (+) | 393 | WP_015764338.1 | YopX family protein | - |
| LC705_RS04190 | - | 858783..859211 (+) | 429 | WP_015992527.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LC705_RS04200 (LC705_00865) | - | 859676..860341 (+) | 666 | WP_015764340.1 | hypothetical protein | - |
| LC705_RS04205 (LC705_00866) | - | 860984..862201 (+) | 1218 | WP_015764341.1 | GcrA family cell cycle regulator | - |
| LC705_RS04210 (LC705_00867) | - | 862188..862718 (+) | 531 | WP_015764342.1 | NUMOD4 domain-containing protein | - |
| LC705_RS16110 | - | 862722..862808 (+) | 87 | Protein_802 | ribonucleoside-diphosphate reductase | - |
| LC705_RS16395 (LC705_00868) | - | 862821..863144 (+) | 324 | WP_015764343.1 | hypothetical protein | - |
| LC705_RS15990 (LC705_00869) | - | 863162..863326 (+) | 165 | WP_015764344.1 | hypothetical protein | - |
| LC705_RS04220 (LC705_00870) | - | 863363..864157 (+) | 795 | WP_015764345.1 | HNH endonuclease | - |
| LC705_RS04225 (LC705_00871) | - | 864358..864813 (+) | 456 | WP_005686963.1 | P27 family phage terminase small subunit | - |
| LC705_RS04230 (LC705_00872) | - | 864835..866547 (+) | 1713 | WP_015764346.1 | terminase large subunit | - |
| LC705_RS04235 (LC705_00873) | - | 866559..866750 (+) | 192 | WP_003661399.1 | hypothetical protein | - |
| LC705_RS04240 (LC705_00874) | - | 866756..868009 (+) | 1254 | WP_015764347.1 | phage portal protein | - |
| LC705_RS04245 (LC705_00875) | - | 867963..868592 (+) | 630 | WP_015764348.1 | HK97 family phage prohead protease | - |
| LC705_RS04250 (LC705_00876) | - | 868634..869836 (+) | 1203 | WP_015764349.1 | phage major capsid protein | - |
| LC705_RS04255 (LC705_00877) | - | 869854..870093 (+) | 240 | WP_005712764.1 | Ig-like domain-containing protein | - |
| LC705_RS04260 (LC705_00878) | - | 870104..870463 (+) | 360 | WP_015764350.1 | head-tail connector protein | - |
| LC705_RS04265 (LC705_00879) | - | 870453..870782 (+) | 330 | WP_041247957.1 | head-tail adaptor protein | - |
| LC705_RS04270 (LC705_00880) | - | 870782..871168 (+) | 387 | WP_015764352.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LC705_RS04275 (LC705_00881) | - | 871168..871554 (+) | 387 | WP_015764353.1 | hypothetical protein | - |
| LC705_RS04280 (LC705_00882) | - | 871588..872205 (+) | 618 | WP_015764354.1 | major tail protein | - |
| LC705_RS04285 (LC705_00883) | gpG | 872305..872718 (+) | 414 | WP_003661382.1 | phage tail assembly chaperone G | - |
| LC705_RS04290 (LC705_00884) | - | 872841..877706 (+) | 4866 | WP_015764355.1 | phage tail tape measure protein | - |
| LC705_RS04295 (LC705_00885) | - | 877707..879629 (+) | 1923 | WP_015764356.1 | distal tail protein Dit | - |
| LC705_RS04300 (LC705_00886) | - | 879629..882130 (+) | 2502 | WP_015764357.1 | phage tail protein | - |
| LC705_RS04305 (LC705_00887) | - | 882127..882414 (+) | 288 | WP_015764358.1 | hypothetical protein | - |
| LC705_RS16130 (LC705_00888) | - | 882431..882538 (+) | 108 | WP_225362667.1 | XkdX family protein | - |
| LC705_RS04315 (LC705_00889) | - | 882568..882861 (+) | 294 | WP_014569500.1 | hypothetical protein | - |
| LC705_RS04320 (LC705_00890) | - | 882851..883264 (+) | 414 | WP_015764360.1 | phage holin | - |
| LC705_RS04325 (LC705_00891) | - | 883275..884459 (+) | 1185 | WP_015764361.1 | GH25 family lysozyme | - |
Sequence
Protein
Download Length: 161 a.a. Molecular weight: 17695.41 Da Isoelectric Point: 6.9824
>NTDB_id=35209 LC705_RS04115 WP_015764328.1 852765..853250(+) (ssb) [Lacticaseibacillus rhamnosus Lc 705]
MLNSVSLTGRLTRDVDLRYTQSGTVTGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTHKGALVGIEGRIQTR
TYDNAQGQKVFVTEVIVDNFALLESRQASQNNPKSQQTANASATATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F
MLNSVSLTGRLTRDVDLRYTQSGTVTGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTHKGALVGIEGRIQTR
TYDNAQGQKVFVTEVIVDNFALLESRQASQNNPKSQQTANASATATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F
Nucleotide
Download Length: 486 bp
>NTDB_id=35209 LC705_RS04115 WP_015764328.1 852765..853250(+) (ssb) [Lacticaseibacillus rhamnosus Lc 705]
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGTGACAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGGGAAACTGATTTCGTAAATTGCCAGATCT
GGCGCAAGTCGGCTGAGAACTTTGCAAATTTCACTCATAAGGGTGCACTTGTTGGCATCGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGACAGAAAGTGTTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GGCGTCTCAGAACAACCCTAAATCACAGCAAACAGCCAATGCATCAGCAACAGCGACCACAAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTTTAA
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGTGACAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGGGAAACTGATTTCGTAAATTGCCAGATCT
GGCGCAAGTCGGCTGAGAACTTTGCAAATTTCACTCATAAGGGTGCACTTGTTGGCATCGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGACAGAAAGTGTTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GGCGTCTCAGAACAACCCTAAATCACAGCAAACAGCCAATGCATCAGCAACAGCGACCACAAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
61.047 |
100 |
0.652 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.674 |
100 |
0.509 |