Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   E3U39_RS07230 Genome accession   NZ_CP038028
Coordinates   1438466..1438585 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain FS1092     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1433466..1443585
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E3U39_RS07205 (E3U39_07205) - 1433707..1434465 (-) 759 WP_053573731.1 ABC transporter ATP-binding protein -
  E3U39_RS07210 (E3U39_07210) - 1434459..1435406 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  E3U39_RS07215 (E3U39_07215) ceuB 1435396..1436349 (-) 954 WP_015239156.1 ABC transporter permease Machinery gene
  E3U39_RS07220 (E3U39_07220) - 1436763..1438127 (+) 1365 WP_033575080.1 aspartate kinase -
  E3U39_RS07225 (E3U39_07225) - 1438222..1438317 (+) 96 WP_012116800.1 YjcZ family sporulation protein -
  E3U39_RS07230 (E3U39_07230) phrC 1438466..1438585 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  E3U39_RS07235 (E3U39_07235) rapC 1438569..1439717 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  E3U39_RS07240 (E3U39_07240) - 1439870..1441303 (-) 1434 WP_162782989.1 HAMP domain-containing sensor histidine kinase -
  E3U39_RS07245 (E3U39_07245) - 1441290..1441973 (-) 684 WP_007410267.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=351578 E3U39_RS07230 WP_003156334.1 1438466..1438585(-) (phrC) [Bacillus amyloliquefaciens strain FS1092]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=351578 E3U39_RS07230 WP_003156334.1 1438466..1438585(-) (phrC) [Bacillus amyloliquefaciens strain FS1092]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment