Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GII85_RS15950 Genome accession   NZ_CP045817
Coordinates   3097125..3097265 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain P5_B1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3092125..3102265
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII85_RS15925 (GII85_15925) yuxO 3092468..3092848 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  GII85_RS15930 (GII85_15930) comA 3092867..3093511 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII85_RS15935 (GII85_15935) comP 3093592..3095892 (-) 2301 WP_041850586.1 histidine kinase Regulator
  GII85_RS15940 (GII85_15940) comX 3095904..3096068 (-) 165 WP_015384519.1 competence pheromone ComX -
  GII85_RS15945 (GII85_15945) comQ 3096081..3096941 (-) 861 WP_041850585.1 polyprenyl synthetase family protein Regulator
  GII85_RS15950 (GII85_15950) degQ 3097125..3097265 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII85_RS21100 - 3097487..3097549 (+) 63 Protein_3092 hypothetical protein -
  GII85_RS15955 (GII85_15955) - 3097728..3098096 (+) 369 WP_041850584.1 hypothetical protein -
  GII85_RS15960 (GII85_15960) pdeH 3098072..3099301 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  GII85_RS15965 (GII85_15965) pncB 3099438..3100910 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GII85_RS15970 (GII85_15970) pncA 3100926..3101477 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  GII85_RS15975 (GII85_15975) yueI 3101574..3101972 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=346850 GII85_RS15950 WP_003220708.1 3097125..3097265(-) (degQ) [Bacillus subtilis strain P5_B1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=346850 GII85_RS15950 WP_003220708.1 3097125..3097265(-) (degQ) [Bacillus subtilis strain P5_B1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1