Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GCU76_RS17700 Genome accession   NZ_CP045425
Coordinates   3237562..3237702 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain JAAA     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3232562..3242702
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GCU76_RS17675 yuxO 3232838..3233218 (-) 381 WP_041052848.1 hotdog fold thioesterase -
  GCU76_RS17680 comA 3233237..3233881 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GCU76_RS17685 comP 3233962..3236274 (-) 2313 WP_103330147.1 sensor histidine kinase Regulator
  GCU76_RS17690 comX 3236290..3236511 (-) 222 WP_014480704.1 competence pheromone ComX -
  GCU76_RS17695 comQ 3236513..3237376 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  GCU76_RS17700 degQ 3237562..3237702 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GCU76_RS17705 - 3237924..3238049 (+) 126 WP_003228793.1 hypothetical protein -
  GCU76_RS17710 - 3238163..3238531 (+) 369 WP_014477834.1 hypothetical protein -
  GCU76_RS17715 pdeH 3238507..3239736 (-) 1230 WP_041339151.1 cyclic di-GMP phosphodiesterase -
  GCU76_RS17720 pncB 3239873..3241345 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GCU76_RS17725 pncA 3241361..3241912 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  GCU76_RS17730 yueI 3242009..3242407 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=344254 GCU76_RS17700 WP_003220708.1 3237562..3237702(-) (degQ) [Bacillus subtilis strain JAAA]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=344254 GCU76_RS17700 WP_003220708.1 3237562..3237702(-) (degQ) [Bacillus subtilis strain JAAA]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1