Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   EU243_RS08955 Genome accession   NZ_CP035533
Coordinates   1757548..1757688 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain DTU001     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1752548..1762688
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EU243_RS08925 (EU243_09070) - 1752854..1753252 (+) 399 WP_003152031.1 YueI family protein -
  EU243_RS08930 (EU243_09075) - 1753349..1753900 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  EU243_RS08935 (EU243_09080) - 1753918..1755384 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  EU243_RS08940 (EU243_09085) - 1755514..1756734 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  EU243_RS08945 (EU243_09090) - 1756741..1757082 (-) 342 WP_046560014.1 hypothetical protein -
  EU243_RS08955 (EU243_09100) degQ 1757548..1757688 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  EU243_RS08960 (EU243_09105) comQ 1757873..1758805 (+) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  EU243_RS08970 (EU243_09115) comP 1758958..1761261 (+) 2304 WP_003152050.1 histidine kinase Regulator
  EU243_RS08975 (EU243_09120) comA 1761342..1761986 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  EU243_RS08980 (EU243_09125) - 1762008..1762391 (+) 384 WP_003152054.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=342988 EU243_RS08955 WP_003152043.1 1757548..1757688(+) (degQ) [Bacillus velezensis strain DTU001]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=342988 EU243_RS08955 WP_003152043.1 1757548..1757688(+) (degQ) [Bacillus velezensis strain DTU001]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment