Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   F7V86_RS02100 Genome accession   NZ_CP044444
Coordinates   394948..395088 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain KC41     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 389948..400088
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F7V86_RS02075 - 390275..390658 (-) 384 WP_104842774.1 hotdog fold thioesterase -
  F7V86_RS02080 comA 390680..391324 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  F7V86_RS02085 comP 391405..393711 (-) 2307 WP_065180455.1 sensor histidine kinase Regulator
  F7V86_RS02090 comX 393730..393906 (-) 177 WP_017419424.1 competence pheromone ComX -
  F7V86_RS02095 comQ 393921..394796 (-) 876 WP_026092320.1 polyprenyl synthetase family protein Regulator
  F7V86_RS02100 degQ 394948..395088 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  F7V86_RS02110 - 395553..395894 (+) 342 WP_014418765.1 hypothetical protein -
  F7V86_RS02115 - 395901..397124 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  F7V86_RS02120 - 397254..398720 (-) 1467 WP_106067969.1 nicotinate phosphoribosyltransferase -
  F7V86_RS02125 - 398738..399289 (-) 552 WP_025853916.1 cysteine hydrolase family protein -
  F7V86_RS02130 - 399386..399784 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=342607 F7V86_RS02100 WP_003152043.1 394948..395088(-) (degQ) [Bacillus amyloliquefaciens strain KC41]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=342607 F7V86_RS02100 WP_003152043.1 394948..395088(-) (degQ) [Bacillus amyloliquefaciens strain KC41]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891