Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | F7V86_RS02100 | Genome accession | NZ_CP044444 |
| Coordinates | 394948..395088 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain KC41 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 389948..400088
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F7V86_RS02075 | - | 390275..390658 (-) | 384 | WP_104842774.1 | hotdog fold thioesterase | - |
| F7V86_RS02080 | comA | 390680..391324 (-) | 645 | WP_014418762.1 | response regulator transcription factor | Regulator |
| F7V86_RS02085 | comP | 391405..393711 (-) | 2307 | WP_065180455.1 | sensor histidine kinase | Regulator |
| F7V86_RS02090 | comX | 393730..393906 (-) | 177 | WP_017419424.1 | competence pheromone ComX | - |
| F7V86_RS02095 | comQ | 393921..394796 (-) | 876 | WP_026092320.1 | polyprenyl synthetase family protein | Regulator |
| F7V86_RS02100 | degQ | 394948..395088 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| F7V86_RS02110 | - | 395553..395894 (+) | 342 | WP_014418765.1 | hypothetical protein | - |
| F7V86_RS02115 | - | 395901..397124 (-) | 1224 | WP_014418766.1 | EAL and HDOD domain-containing protein | - |
| F7V86_RS02120 | - | 397254..398720 (-) | 1467 | WP_106067969.1 | nicotinate phosphoribosyltransferase | - |
| F7V86_RS02125 | - | 398738..399289 (-) | 552 | WP_025853916.1 | cysteine hydrolase family protein | - |
| F7V86_RS02130 | - | 399386..399784 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=342607 F7V86_RS02100 WP_003152043.1 394948..395088(-) (degQ) [Bacillus amyloliquefaciens strain KC41]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=342607 F7V86_RS02100 WP_003152043.1 394948..395088(-) (degQ) [Bacillus amyloliquefaciens strain KC41]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |