Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ETL60_RS12625 Genome accession   NZ_CP035414
Coordinates   2348496..2348879 (-) Length   127 a.a.
NCBI ID   WP_076458111.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103637     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2343496..2353879
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETL60_RS12585 (ETL60_12585) sinI 2344430..2344603 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ETL60_RS12590 (ETL60_12590) sinR 2344637..2344972 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ETL60_RS12595 (ETL60_12595) tasA 2345065..2345850 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ETL60_RS12600 (ETL60_12600) sipW 2345914..2346486 (-) 573 WP_003230181.1 signal peptidase I SipW -
  ETL60_RS12605 (ETL60_12605) tapA 2346470..2347231 (-) 762 WP_087614619.1 amyloid fiber anchoring/assembly protein TapA -
  ETL60_RS12610 (ETL60_12610) yqzG 2347503..2347829 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  ETL60_RS12615 (ETL60_12615) spoIITA 2347871..2348050 (-) 180 WP_014480252.1 YqzE family protein -
  ETL60_RS12620 (ETL60_12620) comGG 2348121..2348495 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  ETL60_RS12625 (ETL60_12625) comGF 2348496..2348879 (-) 384 WP_076458111.1 ComG operon protein ComGF Machinery gene
  ETL60_RS12630 (ETL60_12630) comGE 2348905..2349252 (-) 348 WP_087614620.1 ComG operon protein 5 Machinery gene
  ETL60_RS12635 (ETL60_12635) comGD 2349236..2349667 (-) 432 WP_080529538.1 comG operon protein ComGD Machinery gene
  ETL60_RS12640 (ETL60_12640) comGC 2349657..2349953 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ETL60_RS12645 (ETL60_12645) comGB 2349967..2351004 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  ETL60_RS12650 (ETL60_12650) comGA 2350991..2352061 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ETL60_RS12655 (ETL60_12655) - 2352273..2352470 (-) 198 WP_014480259.1 CBS domain-containing protein -
  ETL60_RS12660 (ETL60_12660) corA 2352472..2353425 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14448.54 Da        Isoelectric Point: 6.2135

>NTDB_id=340878 ETL60_RS12625 WP_076458111.1 2348496..2348879(-) (comGF) [Bacillus subtilis strain SRCM103637]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGR

Nucleotide


Download         Length: 384 bp        

>NTDB_id=340878 ETL60_RS12625 WP_076458111.1 2348496..2348879(-) (comGF) [Bacillus subtilis strain SRCM103637]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGAGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.413

99.213

0.976


Multiple sequence alignment