Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ETL60_RS12585 Genome accession   NZ_CP035414
Coordinates   2344430..2344603 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM103637     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2339430..2349603
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETL60_RS12570 (ETL60_12570) gcvT 2340229..2341317 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  ETL60_RS12575 (ETL60_12575) hepAA 2341759..2343432 (+) 1674 WP_014480248.1 SNF2-related protein -
  ETL60_RS12580 (ETL60_12580) yqhG 2343453..2344247 (+) 795 WP_014480249.1 YqhG family protein -
  ETL60_RS12585 (ETL60_12585) sinI 2344430..2344603 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ETL60_RS12590 (ETL60_12590) sinR 2344637..2344972 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ETL60_RS12595 (ETL60_12595) tasA 2345065..2345850 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ETL60_RS12600 (ETL60_12600) sipW 2345914..2346486 (-) 573 WP_003230181.1 signal peptidase I SipW -
  ETL60_RS12605 (ETL60_12605) tapA 2346470..2347231 (-) 762 WP_087614619.1 amyloid fiber anchoring/assembly protein TapA -
  ETL60_RS12610 (ETL60_12610) yqzG 2347503..2347829 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  ETL60_RS12615 (ETL60_12615) spoIITA 2347871..2348050 (-) 180 WP_014480252.1 YqzE family protein -
  ETL60_RS12620 (ETL60_12620) comGG 2348121..2348495 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  ETL60_RS12625 (ETL60_12625) comGF 2348496..2348879 (-) 384 WP_076458111.1 ComG operon protein ComGF Machinery gene
  ETL60_RS12630 (ETL60_12630) comGE 2348905..2349252 (-) 348 WP_087614620.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=340875 ETL60_RS12585 WP_003230187.1 2344430..2344603(+) (sinI) [Bacillus subtilis strain SRCM103637]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=340875 ETL60_RS12585 WP_003230187.1 2344430..2344603(+) (sinI) [Bacillus subtilis strain SRCM103637]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment