Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ETK69_RS12910 | Genome accession | NZ_CP035410 |
| Coordinates | 2600082..2600255 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain SRCM103616 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2595082..2605255
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETK69_RS12895 (ETK69_12895) | gcvT | 2595895..2596995 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ETK69_RS12900 (ETK69_12900) | - | 2597419..2599089 (+) | 1671 | WP_017418135.1 | SNF2-related protein | - |
| ETK69_RS12905 (ETK69_12905) | - | 2599111..2599905 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| ETK69_RS12910 (ETK69_12910) | sinI | 2600082..2600255 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| ETK69_RS12915 (ETK69_12915) | sinR | 2600289..2600624 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ETK69_RS12920 (ETK69_12920) | - | 2600672..2601457 (-) | 786 | WP_017418136.1 | TasA family protein | - |
| ETK69_RS12925 (ETK69_12925) | - | 2601522..2602106 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| ETK69_RS12930 (ETK69_12930) | tapA | 2602078..2602749 (-) | 672 | WP_025649852.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ETK69_RS12935 (ETK69_12935) | - | 2603008..2603337 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ETK69_RS12940 (ETK69_12940) | - | 2603378..2603557 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ETK69_RS12945 (ETK69_12945) | comGG | 2603614..2603991 (-) | 378 | WP_025649851.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ETK69_RS12950 (ETK69_12950) | comGF | 2603992..2604387 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| ETK69_RS12955 (ETK69_12955) | comGE | 2604401..2604715 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ETK69_RS12960 (ETK69_12960) | comGD | 2604699..2605136 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=340639 ETK69_RS12910 WP_014418369.1 2600082..2600255(+) (sinI) [Bacillus velezensis strain SRCM103616]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=340639 ETK69_RS12910 WP_014418369.1 2600082..2600255(+) (sinI) [Bacillus velezensis strain SRCM103616]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |