Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   ETK69_RS12955 Genome accession   NZ_CP035410
Coordinates   2604401..2604715 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain SRCM103616     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2599401..2609715
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETK69_RS12910 (ETK69_12910) sinI 2600082..2600255 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  ETK69_RS12915 (ETK69_12915) sinR 2600289..2600624 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ETK69_RS12920 (ETK69_12920) - 2600672..2601457 (-) 786 WP_017418136.1 TasA family protein -
  ETK69_RS12925 (ETK69_12925) - 2601522..2602106 (-) 585 WP_012117977.1 signal peptidase I -
  ETK69_RS12930 (ETK69_12930) tapA 2602078..2602749 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  ETK69_RS12935 (ETK69_12935) - 2603008..2603337 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ETK69_RS12940 (ETK69_12940) - 2603378..2603557 (-) 180 WP_003153093.1 YqzE family protein -
  ETK69_RS12945 (ETK69_12945) comGG 2603614..2603991 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  ETK69_RS12950 (ETK69_12950) comGF 2603992..2604387 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  ETK69_RS12955 (ETK69_12955) comGE 2604401..2604715 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETK69_RS12960 (ETK69_12960) comGD 2604699..2605136 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETK69_RS12965 (ETK69_12965) comGC 2605126..2605434 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  ETK69_RS12970 (ETK69_12970) comGB 2605439..2606476 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETK69_RS12975 (ETK69_12975) comGA 2606463..2607533 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  ETK69_RS12980 (ETK69_12980) - 2607726..2608678 (-) 953 Protein_2507 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=340642 ETK69_RS12955 WP_017418140.1 2604401..2604715(-) (comGE) [Bacillus velezensis strain SRCM103616]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=340642 ETK69_RS12955 WP_017418140.1 2604401..2604715(-) (comGE) [Bacillus velezensis strain SRCM103616]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment