Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ETK61_RS13585 Genome accession   NZ_CP035406
Coordinates   2499139..2499312 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM103612     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2494139..2504312
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETK61_RS13570 (ETK61_13575) gcvT 2494938..2496026 (-) 1089 WP_129137784.1 glycine cleavage system aminomethyltransferase GcvT -
  ETK61_RS13575 (ETK61_13580) hepAA 2496468..2498141 (+) 1674 WP_004398544.1 SNF2-related protein -
  ETK61_RS13580 (ETK61_13585) yqhG 2498162..2498956 (+) 795 WP_003230200.1 YqhG family protein -
  ETK61_RS13585 (ETK61_13590) sinI 2499139..2499312 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ETK61_RS13590 (ETK61_13595) sinR 2499346..2499681 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ETK61_RS13595 (ETK61_13600) tasA 2499774..2500559 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  ETK61_RS13600 (ETK61_13605) sipW 2500623..2501195 (-) 573 WP_080031082.1 signal peptidase I SipW -
  ETK61_RS13605 (ETK61_13610) tapA 2501179..2501934 (-) 756 WP_129137785.1 amyloid fiber anchoring/assembly protein TapA -
  ETK61_RS13610 (ETK61_13615) yqzG 2502206..2502532 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ETK61_RS13615 (ETK61_13620) spoIITA 2502574..2502753 (-) 180 WP_003230176.1 YqzE family protein -
  ETK61_RS13620 (ETK61_13625) comGG 2502824..2503198 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  ETK61_RS13625 (ETK61_13630) comGF 2503199..2503582 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  ETK61_RS13630 (ETK61_13635) comGE 2503608..2503955 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=340561 ETK61_RS13585 WP_003230187.1 2499139..2499312(+) (sinI) [Bacillus subtilis strain SRCM103612]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=340561 ETK61_RS13585 WP_003230187.1 2499139..2499312(+) (sinI) [Bacillus subtilis strain SRCM103612]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment