Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ETK49_RS17400 Genome accession   NZ_CP035405
Coordinates   3305960..3306100 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain SRCM103608     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3300960..3311100
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETK49_RS17375 (ETK49_17375) - 3301257..3301646 (-) 390 WP_003184847.1 hotdog fold thioesterase -
  ETK49_RS17380 (ETK49_17380) comA 3301663..3302301 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  ETK49_RS17385 (ETK49_17385) comP 3302388..3304694 (-) 2307 WP_119498753.1 ATP-binding protein Regulator
  ETK49_RS17390 (ETK49_17390) comX 3304717..3304881 (-) 165 WP_003184853.1 competence pheromone ComX -
  ETK49_RS17395 (ETK49_17395) - 3304890..3305771 (-) 882 WP_003184856.1 polyprenyl synthetase family protein -
  ETK49_RS17400 (ETK49_17400) degQ 3305960..3306100 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  ETK49_RS17410 (ETK49_17410) - 3306586..3306933 (+) 348 WP_009329512.1 hypothetical protein -
  ETK49_RS17415 (ETK49_17415) - 3306976..3308196 (-) 1221 WP_003184864.1 HDOD domain-containing protein -
  ETK49_RS17420 (ETK49_17420) - 3308375..3309844 (-) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  ETK49_RS17425 (ETK49_17425) - 3309862..3310413 (-) 552 WP_003184868.1 isochorismatase family cysteine hydrolase -
  ETK49_RS17430 (ETK49_17430) - 3310598..3310999 (-) 402 WP_003184870.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=340505 ETK49_RS17400 WP_003184860.1 3305960..3306100(-) (degQ) [Bacillus licheniformis strain SRCM103608]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=340505 ETK49_RS17400 WP_003184860.1 3305960..3306100(-) (degQ) [Bacillus licheniformis strain SRCM103608]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment