Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ETA57_RS14000 Genome accession   NZ_CP035404
Coordinates   2675198..2675374 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain SRCM103583     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2670198..2680374
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA57_RS13985 (ETA57_13985) gcvT 2670840..2671934 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  ETA57_RS13990 (ETA57_13990) - 2672527..2674206 (+) 1680 WP_003183439.1 SNF2-related protein -
  ETA57_RS13995 (ETA57_13995) - 2674213..2675007 (+) 795 WP_003183441.1 YqhG family protein -
  ETA57_RS14000 (ETA57_14000) sinI 2675198..2675374 (+) 177 WP_003183444.1 anti-repressor SinI family protein Regulator
  ETA57_RS14005 (ETA57_14005) sinR 2675408..2675743 (+) 336 WP_006637528.1 helix-turn-helix domain-containing protein Regulator
  ETA57_RS14010 (ETA57_14010) - 2675848..2676642 (-) 795 WP_003183447.1 TasA family protein -
  ETA57_RS14015 (ETA57_14015) - 2676716..2677300 (-) 585 WP_003183449.1 signal peptidase I -
  ETA57_RS14020 (ETA57_14020) tapA 2677297..2678025 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  ETA57_RS14025 (ETA57_14025) - 2678335..2678622 (+) 288 WP_223307118.1 YqzG/YhdC family protein -
  ETA57_RS14030 (ETA57_14030) - 2678652..2678834 (-) 183 WP_003183456.1 YqzE family protein -
  ETA57_RS14035 (ETA57_14035) comGG 2678923..2679288 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  ETA57_RS14040 (ETA57_14040) comGF 2679301..2679789 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  ETA57_RS14045 (ETA57_14045) comGE 2679698..2680045 (-) 348 WP_026699160.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=340414 ETA57_RS14000 WP_003183444.1 2675198..2675374(+) (sinI) [Bacillus licheniformis strain SRCM103583]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=340414 ETA57_RS14000 WP_003183444.1 2675198..2675374(+) (sinI) [Bacillus licheniformis strain SRCM103583]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517


Multiple sequence alignment