Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   ETA18_RS16350 Genome accession   NZ_CP035400
Coordinates   3123793..3123960 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain SRCM103835     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3118793..3128960
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA18_RS16320 (ETA18_16320) mrpE 3119188..3119664 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  ETA18_RS16325 (ETA18_16325) mrpF 3119664..3119948 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  ETA18_RS16330 (ETA18_16330) mnhG 3119932..3120306 (+) 375 WP_015714623.1 monovalent cation/H(+) antiporter subunit G -
  ETA18_RS16335 (ETA18_16335) yuxO 3120345..3120725 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  ETA18_RS16340 (ETA18_16340) comA 3120744..3121388 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ETA18_RS16345 (ETA18_16345) comP 3121469..3123778 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  ETA18_RS16350 (ETA18_16350) comX 3123793..3123960 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  ETA18_RS16355 (ETA18_16355) comQ 3123948..3124847 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ETA18_RS16360 (ETA18_16360) degQ 3125032..3125172 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ETA18_RS16365 (ETA18_16365) - 3125394..3125519 (+) 126 WP_003228793.1 hypothetical protein -
  ETA18_RS16370 (ETA18_16370) - 3125633..3126001 (+) 369 WP_128993338.1 hypothetical protein -
  ETA18_RS16375 (ETA18_16375) pdeH 3125977..3127206 (-) 1230 WP_128993339.1 cyclic di-GMP phosphodiesterase -
  ETA18_RS16380 (ETA18_16380) pncB 3127343..3128815 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=340120 ETA18_RS16350 WP_003242801.1 3123793..3123960(-) (comX) [Bacillus subtilis strain SRCM103835]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=340120 ETA18_RS16350 WP_003242801.1 3123793..3123960(-) (comX) [Bacillus subtilis strain SRCM103835]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment